PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_09888A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NF-YB
Protein Properties Length: 276aa    MW: 30360.1 Da    PI: 6.2626
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_09888AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.88.5e-5517112297
                      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 
                                +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyv+p++ 
  Oropetium_20150105_09888A  17 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDDYVDPMRR 100
                                89********************************************************************************** PP

                      NF-YB  86 ylkkyrelegek 97 
                                yl+kyre+eg++
  Oropetium_20150105_09888A 101 YLHKYREVEGDR 112
                                **********97 PP

2NF-YB142.97.7e-45153244495
                      NF-YB   4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                                qd++lPian++rimk vlP  +kisk aket+qec++ef++fvt+eas++c+re+rktingdd+++a+ +lG+++y+++++vyl
  Oropetium_20150105_09888A 153 QDNLLPIANIGRIMKDVLPPTGKISKRAKETIQECATEFVGFVTGEASERCRRERRKTINGDDICHAMMSLGLDHYADAMRVYL 236
                                89********************************************************************************** PP

                      NF-YB  88 kkyreleg 95 
                                ++yre e+
  Oropetium_20150105_09888A 237 QRYRESEE 244
                                *****885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.9E-5014118IPR009072Histone-fold
SuperFamilySSF471139.16E-3919140IPR009072Histone-fold
PfamPF008081.3E-262285IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.4E-175068No hitNo description
PROSITE patternPS0068505369IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.4E-176987No hitNo description
PRINTSPR006155.4E-1788106No hitNo description
Gene3DG3DSA:1.10.20.101.2E-40148246IPR009072Histone-fold
SuperFamilySSF471132.64E-32153248IPR009072Histone-fold
PfamPF008082.1E-23157220IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MADQPDGRPG AAADEIKEQD RLLPIANVGR IMKQILPPNA KISKEAKETM QECVSEFISF  60
VTGEASDKCH KEKRKTVNGD DVCWAFGALG FDDYVDPMRR YLHKYREVEG DRAAAAASSR  120
GPASDSGAGA AGPSGTVIST STHANNDGIN NIQDNLLPIA NIGRIMKDVL PPTGKISKRA  180
KETIQECATE FVGFVTGEAS ERCRRERRKT INGDDICHAM MSLGLDHYAD AMRVYLQRYR  240
ESEELTATLN RSTGREIHID VRDELSVFRN NDKLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4116241192Transcription factor HapC (Eurofung)
4g92_B1e-4116241192Transcription factor HapC (Eurofung)
5g49_A1e-4116241697NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. {ECO:0000250}.
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_09888A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9701981e-138EU970198.1 Zea mays clone 342117 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635864.11e-69nuclear transcription factor Y subunit B-1
RefseqXP_015635872.11e-69nuclear transcription factor Y subunit B-1
SwissprotO822481e-54NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
SwissprotQ75IZ71e-53NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8
TrEMBLA0A0D9V9Y71e-120A0A0D9V9Y7_9ORYZ; Uncharacterized protein
STRINGLPERR01G37540.11e-121(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29173887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.13e-55nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Kim SK, et al.
    OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice.
    Planta, 2016. 243(3): p. 563-76
    [PMID:26542958]
  3. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]