PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_09502A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 86aa    MW: 9648.15 Da    PI: 12.3647
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_09502AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26063.26.6e-20568770
                     DUF260  7 vlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearar 70
                                lrr+C+++Cvlapyfpa+q ++f++vh++FGasnv k+l++l+ e+r +a + l     ar r
  Oropetium_20150105_09502A  5 RLRRRCVPSCVLAPYFPAHQGARFRAVHRVFGASNVAKMLADLRLEDRAEASERLRERTMARSR 68
                               689**********************************************999888766666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089114.783185IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-20476IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MTRRRLRRRC VPSCVLAPYF PAHQGARFRA VHRVFGASNV AKMLADLRLE DRAEASERLR  60
ERTMARSRAR FAGTCGSRPS ASSRT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-154771689LOB family transfactor Ramosa2.1
5ly0_B2e-154771689LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_09502A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009421201.15e-17PREDICTED: LOB domain-containing protein 12-like
SwissprotO221324e-16LBD19_ARATH; LOB domain-containing protein 19
STRINGLus100075251e-16(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.15e-16LOB domain-containing protein 2