PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_09185A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 351aa    MW: 38922.1 Da    PI: 9.8901
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_09185AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.55e-072192551753
                                HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                                A+rsR RK+++i+eLe+kv++L++e  +   e+e l+
  Oropetium_20150105_09185A 219 AQRSRVRKLQYIAELERKVQALQSEGIEVSAEMEFLT 255
                                89**********************9777666666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.5E-6208267IPR004827Basic-leucine zipper domain
CDDcd147037.63E-17209259No hitNo description
SuperFamilySSF579592.42E-6218261No hitNo description
Gene3DG3DSA:1.20.5.1702.8E-6219261No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MMANGRLQKQ APLPPRSPFP TAAAPYADHG LITRPQGASH HRHAHGQGHH QRTSSESFIE  60
EQPSWLDDLL NEPDTPVRQH GRAGHRRSSS DSFALFDGGA TGAGVCANGF KATGRGGGKA  120
APWGGVQEYY AKPGSFGRPQ GRPWEQGMPN LGGYRAPMPA KEKSGGHHGL SSASRNHDHG  180
MDNRAPDDAG HDHKFGKEGM PPKHAQSEAD TKRAKQQYAQ RSRVRKLQYI AELERKVQAL  240
QSEGIEVSAE MEFLTQQNIM LDLENKALKQ RLESLAQEQL IKRFQQEMFE REIGRLRSLY  300
QQQQQQEQPS QAHPLDRSNS RDLDSYFANL SLKHKDPNSG RDTLSGPLRT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006662832.21e-177PREDICTED: uncharacterized protein At4g06598-like
TrEMBLA0A0A9E2N80.0A0A0A9E2N8_ARUDO; Uncharacterized protein
STRINGOB11G15450.11e-176(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.23e-66bZIP family protein