PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_08802A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family B3
Protein Properties Length: 188aa    MW: 19746.3 Da    PI: 8.9755
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_08802AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B336.87e-121001463987
                                EETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                         B3  39 edesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                                 + +grsW++++  +++++   l++GW++F+ +ngL+ gD +vF+l ++
  Oropetium_20150105_08802A 100 LTWRGRSWDMRF--TGGRQIQRLEAGWRGFALDNGLRLGDGCVFELLDN 146
                                56689*******..9999999************************8654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.55E-1469164IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.7E-1369166IPR015300DNA-binding pseudobarrel domain
CDDcd100175.67E-1171164No hitNo description
PfamPF023625.5E-999146IPR003340B3 DNA binding domain
PROSITE profilePS5086311.575103166IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MASDSNTAVN PRSLISCGTA GTSKRKAVAN SAEINSGEDA VAAGAPSGPD LQLVPKDTSY  60
ADRIKPLSGK PYFTCVMCKS HVVPRSLAPF LPSSMVPAVL TWRGRSWDMR FTGGRQIQRL  120
EAGWRGFALD NGLRLGDGCV FELLDNGAAD QGGGTVRFSV QVLRASIPSA IRERAGGYTS  180
SSPIEID*
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_08802A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9524083e-48EU952408.1 Zea mays clone 1279890 mRNA sequence.
GenBankEU9541643e-48EU954164.1 Zea mays clone 1457632 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975400.12e-62B3 domain-containing protein Os04g0386900
SwissprotQ7XLP46e-58Y4869_ORYSJ; B3 domain-containing protein Os04g0386900
TrEMBLA0A0A9HBU52e-64A0A0A9HBU5_ARUDO; Uncharacterized protein
STRINGSi012575m1e-60(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89543545
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]