PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_08504A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GRAS
Protein Properties Length: 1003aa    MW: 113569 Da    PI: 4.8552
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_08504AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS48.81.3e-15166220155
                       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar 55 
                                l++ L++cA+av++gdl+ a+++L r+++++sp+gd++qRla +f+e+L+arla+
  Oropetium_20150105_08504A 166 LRTMLIHCAQAVATGDLQSANETLRRIKQHSSPTGDATQRLAYCFAEGLEARLAG 220
                                5789*************************************************98 PP

2GRAS222.71.8e-68224472121366
                       GRAS 121 qGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEal 202
                                 G+QWp Ll++La+R++gpp++RiTg++ p++g   + ++e+tgerL++ A++++vpf+f++ +a ++e+++ e+L+++p+E+l
  Oropetium_20150105_08504A 224 LGFQWPGLLHSLANREGGPPEVRITGIDLPQPGfrPAYQIEKTGERLSNCARQFRVPFKFHA-IAAKWETVTAEDLNIDPDEVL 306
                                69******************************99999*************************.799****************** PP

                       GRAS 203 aVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                                +Vn+   l +l+desv ++s  +rd vL  +++++P v++++  +   +++ Fl+rf eal +ysa fd+l+a++pr+++ r  
  Oropetium_20150105_08504A 307 VVNCECFLDKLMDESVLVDSpsPRDMVLTNIRNMRPSVFIHCVVNGTFGAPFFLTRFREALFFYSAQFDMLDATIPRDNDVRLL 390
                                ***************98887779************************************************************* PP

                       GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                                +Er +lgr++ nv+acega+r+er et+++W+ r ++aG++++pl+ +++k +k  +  ++ + + ++e++ +l++gWk+r+
  Oropetium_20150105_08504A 391 IERDILGRSALNVIACEGADRVERPETYKQWQVRNNRAGLRQLPLRADVVKFVKDKVTDHYHKDFLIDEDHRWLLQGWKGRE 472
                                *************************************************************888***************985 PP

3GRAS203.61.1e-62753996133373
                       GRAS 133 asRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll 214
                                ++ ++gpp++RiTg++ p++g   + ++eetg+rL+kfA+++gvpf+f+  ++ +++++++++L+++p+E+l+Vn ++q  +l+
  Oropetium_20150105_08504A 753 STWEGGPPEVRITGIDLPQPGfrPASRIEETGRRLSKFAHQFGVPFKFHS-ITAKWDAVSVDDLNIDPHEVLIVNGIVQFGNLM 835
                                455799**************9*9***************************.6999***************************** PP

                       GRAS 215 desvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                                de v + s  +rd vL+ +++++P+v++++  + + +++ F++rf eal +ysa+fd+l+a++pr++e+r +vEr ++gr + n
  Oropetium_20150105_08504A 836 DEGVGIYSpsPRDVVLQNIRNMRPDVFILCVVNGSFGAPFFVTRFREALFHYSAMFDMLDATMPRDDEQRLFVERDIIGRCALN 919
                                ***99988779************************************************************************* PP

                       GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                v++ceg +r+er e++++W+ r ++aG++++pl+ +++k  +  ++k + + + ++ ++++l++gWk+r ++++S W
  Oropetium_20150105_08504A 920 VISCEGLDRVERPESYKQWQVRNHQAGLRELPLRPDIVKILRDKVKKEYHKDFLIDVDHHWLLQGWKGRIIYAMSTW 996
                                ************************************************9888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS509859.446140223IPR005202Transcription factor GRAS
PfamPF035144.4E-13166220IPR005202Transcription factor GRAS
PfamPF035146.4E-66224472IPR005202Transcription factor GRAS
PROSITE profilePS5098537.006225460IPR005202Transcription factor GRAS
PROSITE profilePS5098531.623752977IPR005202Transcription factor GRAS
PfamPF035143.9E-60753996IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 1003 aa     Download sequence    Send to blast
MEEDIDDKFF YQYPDHPTLL TAQQPYAQIL SAPSSSDSAT TTTTTTTLSP SWSSDAAEPT  60
WPYDPKEEVV VADGMSIFRE SNNGRGRKNR HHEDDLEAEF GRNSKLMMPE QEETDAQEIY  120
RELMSFNVEE FMKRMQDLRI AMDSESEKSS RKVSRGKKGA NEVVDLRTML IHCAQAVATG  180
DLQSANETLR RIKQHSSPTG DATQRLAYCF AEGLEARLAG TGSLGFQWPG LLHSLANREG  240
GPPEVRITGI DLPQPGFRPA YQIEKTGERL SNCARQFRVP FKFHAIAAKW ETVTAEDLNI  300
DPDEVLVVNC ECFLDKLMDE SVLVDSPSPR DMVLTNIRNM RPSVFIHCVV NGTFGAPFFL  360
TRFREALFFY SAQFDMLDAT IPRDNDVRLL IERDILGRSA LNVIACEGAD RVERPETYKQ  420
WQVRNNRAGL RQLPLRADVV KFVKDKVTDH YHKDFLIDED HRWLLQGWKG RESQGQGSFL  480
TEPFSPSIFL DLPPTPRPDG DGENLAPVDD LVLPFISRML MEEDIEDKFF YQYPDHPELL  540
QAQQTYADIL SGAATTSAGS DSAATNTEGS CPSPSSTDAP EFANATWPYD PVELYQLLVS  600
APNTHTNIVN MESLNLAFLR GMEEAKKFLP TNNGLLLKGL EDSTSREDLP VPSDTKICGR  660
GRKNRRRIWD DIEEDAEMGR NSKLMVPEPE ETGEMVDKMI FDGHKICEEK MKSMSISMGS  720
EVGKNTRRSV QGRYDEAVDL RALLIQCAQA FFSTWEGGPP EVRITGIDLP QPGFRPASRI  780
EETGRRLSKF AHQFGVPFKF HSITAKWDAV SVDDLNIDPH EVLIVNGIVQ FGNLMDEGVG  840
IYSPSPRDVV LQNIRNMRPD VFILCVVNGS FGAPFFVTRF REALFHYSAM FDMLDATMPR  900
DDEQRLFVER DIIGRCALNV ISCEGLDRVE RPESYKQWQV RNHQAGLREL PLRPDIVKIL  960
RDKVKKEYHK DFLIDVDHHW LLQGWKGRII YAMSTWVADE SV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-221709968374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450062.10.0hypothetical protein SORBIDRAFT_05g027740
SwissprotQ9XE586e-93SCL14_ARATH; Scarecrow-like protein 14
TrEMBLC5Y8L20.0C5Y8L2_SORBI; Putative uncharacterized protein Sb05g027740
STRINGSb05g027740.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29065.18e-90GRAS family protein