PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_08274A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 194aa    MW: 20537.4 Da    PI: 8.282
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_08274AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.65.2e-44211201100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrr+Ca++Cv+apyfp ++p+kfanvhk+FGasnv+k+l+++p ++r d++sslvyeA+ar+rdPvyG+v+ i++lq
  Oropetium_20150105_08274A  21 PCAACKLLRRRCAAGCVFAPYFPPAEPHKFANVHKVFGASNVSKMLQEIPVQHRGDTVSSLVYEANARIRDPVYGCVAAISSLQ 104
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                qq+e+l+a+lal+++e
  Oropetium_20150105_08274A 105 QQVETLQAQLALAQAE 120
                                ************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.25620121IPR004883Lateral organ boundaries, LOB
PfamPF031959.9E-4421118IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MKDEFAPVAG KAGASSSASA PCAACKLLRR RCAAGCVFAP YFPPAEPHKF ANVHKVFGAS  60
NVSKMLQEIP VQHRGDTVSS LVYEANARIR DPVYGCVAAI SSLQQQVETL QAQLALAQAE  120
MVRLNMNNAY MAHRLKAARG CGGGGSSTNT GSPSSMSSPK TEQPEAHCKA TPALLDMVVD  180
QPYSMDDSQL WSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-49121232113LOB family transfactor Ramosa2.1
5ly0_B2e-49121232113LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_08274A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0699111e-154BT069911.1 Zea mays full-length cDNA clone ZM_BFb0321D10 mRNA, complete cds.
GenBankKJ7276501e-154KJ727650.1 Zea mays clone pUT5577 LOB transcription factor (LOB19) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466719.14e-84LOB domain-containing protein 4 isoform X1
SwissprotQ8LBW32e-55LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A3L6TSK84e-90A0A3L6TSK8_PANMI; LOB domain-containing protein 4-like
STRINGSb01g012810.11e-83(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.14e-36LOB domain-containing protein 4
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]