PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_08214A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GRF
Protein Properties Length: 424aa    MW: 46206.6 Da    PI: 8.9481
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_08214AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.36.6e-24152196145
                        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                d+epgrCrRtDGKkWRCs+++++++k+CErH++r+r+rsrk++e+
  Oropetium_20150105_08214A 152 DPEPGRCRRTDGKKWRCSKEAMADHKYCERHINRNRHRSRKPVEN 196
                                79****************************************997 PP

2QLQ57.24.9e-20107142237
                        QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                +FT++Q+++L++Q+l+yKyL+a++P+P+ Ll  i+k
  Oropetium_20150105_08214A 107 PFTPSQWMELEHQALIYKYLNAKAPIPSSLLISISK 142
                                9******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.6E-11106142IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.5E-14107140IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.762107142IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.803152196IPR014977WRC domain
PfamPF088793.7E-20153195IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MSAGFTLSAS AAAPAAAAME LGEVMGLQGL SVTAPSPKDS DMGGVLRRGG GGGFTTAASY  60
PSPFLDEQKM LRFSKAAATA AAQTLPSGLD VGRPSEQAFL LSRTKRPFTP SQWMELEHQA  120
LIYKYLNAKA PIPSSLLISI SKSFRSSNRE SDPEPGRCRR TDGKKWRCSK EAMADHKYCE  180
RHINRNRHRS RKPVENQPRK SSKEAPDGSL SCVVSQGSLK KAKVNDLKPG TVSYWTDSLN  240
RTMLSREKAN KQTEDNNAPL LNSTSRQPTL SLLSQLKQQN KPDNFSPSAD SESISSETAL  300
QAWGSGNQQS NRNVSSSHLQ DADGLESVLQ NFSLTNNEKM ESEKNKYPDS MLVSSTFYST  360
EGPRTTFLSP NISQVQEDCI SSSWEMPQGG PLGEILTNSK NSEDLAKCEP RSYGWLLNLD  420
HAT*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_08214A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982189.10.0growth-regulating factor 9
SwissprotQ9FRG80.0GRF9_ORYSJ; Growth-regulating factor 9
TrEMBLA0A0A9FXX90.0A0A0A9FXX9_ARUDO; Uncharacterized protein
STRINGSi035794m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131242529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.12e-32growth-regulating factor 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]