PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_08043A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GeBP
Protein Properties Length: 353aa    MW: 38486.6 Da    PI: 7.6977
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_08043AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57386.63.2e-2770164297
                     DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehd 85 
                                +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++sql+eK+rrLK+K++ ++ ++++g +p+  ++hd
  Oropetium_20150105_08043A  70 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRSQLSEKLRRLKNKYRSMSGRVAKGLDPARLAPHD 152
                                79*******************.556878888***************************************************** PP

                     DUF573  86 qkifelskkiWg 97 
                                +++++l++++W+
  Oropetium_20150105_08043A 153 RDVLHLCSRLWD 164
                                ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.9E-2571164IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MASDQQTLPV PVPFPPNPSA TPTAPADPTP XXXXXXXXXX IKRRSPRPSS SSPHSSGSDH  60
QGQQQPPPFK FQRIWSESDE LRFLQGLLGC GAQGLVFPRD LNVFYDRFSE SMPQPYTRSQ  120
LSEKLRRLKN KYRSMSGRVA KGLDPARLAP HDRDVLHLCS RLWDPANATT SPFAAGAGSG  180
ASGNKRRSSN PRGTMLSLPD ASGDSNSRDY NGVSFPDGSN GEDLFFLEQE SGHLGNIEGA  240
PLVADGTFSG IALEQPQTIA AVPIGNHGIV TEMNENHKLV VPSSNEHRMA NAVLDVFEEC  300
LREAKANRIF NLDGSAEESV LAKRWKAQRM HELDVLSRRL RLLVEDAAAA GR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_08043A
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0944721e-130FP094472.1 Phyllostachys edulis cDNA clone: bphylf057n04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464013.11e-159probable transcription factor At3g04930
RefseqXP_021307245.11e-159probable transcription factor At3g04930
TrEMBLC5WNQ31e-158C5WNQ3_SORBI; Uncharacterized protein
STRINGSb01g010570.11e-158(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.23e-11DNA-binding storekeeper protein-related transcriptional regulator