PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07818A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 128aa    MW: 13757.6 Da    PI: 6.4911
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07818AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26061.72e-191975157
                     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeereda 57
                               +CaaCk +rrkC++dC+lapyfp ++p+++a+v+++FGasn+ ++l+ +   + +++
  Oropetium_20150105_07818A 19 RCAACKNQRRKCSHDCALAPYFPVTDPQRYACVQRIFGASNIARVLQPAAAADTHQL 75
                               6*********************************************98877666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.88618120IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-181976IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MSSMSATSTE AAAANPSRRC AACKNQRRKC SHDCALAPYF PVTDPQRYAC VQRIFGASNI  60
ARVLQPAAAA DTHQLLNAQV QAPPPPQQQL AGNALMMVVH EPFQELDTLL LDDVHAADNL  120
FVDDKIV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_07818A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466327.11e-29LOB domain-containing protein 24
TrEMBLC5WY442e-28C5WY44_SORBI; Uncharacterized protein
STRINGSb01g005700.14e-29(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1972078
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.13e-14LOB domain-containing protein 24