PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07468A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GRAS
Protein Properties Length: 502aa    MW: 56421.8 Da    PI: 6.4446
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07468AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS134.89.6e-421883813203
                       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                                 lL+ c +av++++++ a +lL++++ +as +g+++qRla++f+++L+arl++++s+l+      + +   ++++l al +++ 
  Oropetium_20150105_07468A 188 ALLIYCSQAVAANNHTSAWQLLKEIKVHASTNGNATQRLAQCFAKGLKARLVGTGSHLC------QLP---VVDSLEALLVYVT 262
                                589**************************************************777776......444...7888999999*** PP

                       GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakf 168
                                ++P+ k++      ++++ ++g++++Hi+D+++ +G+QW++L+q La+R++gpp++++T++++pe+    +e+++etg+ L+k 
  Oropetium_20150105_07468A 263 ACPFDKVTLCFPVITLMDMIAGKRKLHIVDYGLDYGFQWVCLFQLLAKRAGGPPEVKLTAISHPEHRsyLTERMQETGRLLHKC 346
                                *****************************************************************999899************* PP

                       GRAS 169 Aeelgvp.fefnvlvakrledleleeLrvkpgEala 203
                                A +lg+p f+f + ++++led+ +++L+++++E l+
  Oropetium_20150105_07468A 347 AINLGLPsFKFYA-LSTNLEDVCIKDLKTDNNELLV 381
                                ******66*****.599***************9875 PP

2GRAS68.41.4e-21382485225329
                       GRAS 225 devLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrer 308
                                d+vL  ++ ++P+v++ +  ++ + + sF  rf  al yy+++fd+l++++p+es++r+++E+ l+g+ ++nv+a eg + ++ 
  Oropetium_20150105_07468A 382 DTVLGNIRMMRPDVFIQSIIDCAY-GISFSSRFKGALLYYTSIFDMLDVTIPQESKQRMVLEQILIGQFAQNVIASEGVDVVQH 464
                                79**********************.789******************************************************** PP

                       GRAS 309 hetlekWrerleeaGFkpvpl 329
                                 e++ +W++r ++aG++ ++ 
  Oropetium_20150105_07468A 465 PEKFVQWQARNQRAGLRMANG 485
                                ***************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.737160501IPR005202Transcription factor GRAS
PfamPF035143.3E-39188381IPR005202Transcription factor GRAS
PfamPF035144.8E-19382485IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MSCFCNKSFQ KEQRISPSDM MLAYISCMLM EDDIEDKLFD HPTLLQEPKY LLQDGNYCER  60
TSEPSFEKGA DAVEAFLKGM EEGKMFLPND DSFSEDGLVN HLFKESPNHT CPRKGYNKDN  120
HLDDETTMTM TNGSESVDTN KMLHEMMVQG YDKCSRDMEK LRNTMANEVE KSRKGVSNTT  180
KAVVDLPALL IYCSQAVAAN NHTSAWQLLK EIKVHASTNG NATQRLAQCF AKGLKARLVG  240
TGSHLCQLPV VDSLEALLVY VTACPFDKVT LCFPVITLMD MIAGKRKLHI VDYGLDYGFQ  300
WVCLFQLLAK RAGGPPEVKL TAISHPEHRS YLTERMQETG RLLHKCAINL GLPSFKFYAL  360
STNLEDVCIK DLKTDNNELL VDTVLGNIRM MRPDVFIQSI IDCAYGISFS SRFKGALLYY  420
TSIFDMLDVT IPQESKQRMV LEQILIGQFA QNVIASEGVD VVQHPEKFVQ WQARNQRAGL  480
RMANGSYRGG WGESSLPTRR G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-221904728315GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964176.11e-147PREDICTED: scarecrow-like protein 33
TrEMBLK3ZDK11e-147K3ZDK1_SETIT; Uncharacterized protein
STRINGSi024639m1e-146(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.12e-67GRAS family protein