PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_06693A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 377aa    MW: 40346.2 Da    PI: 6.5939
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_06693AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.31e-10184242563
                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l+ l+     l++e+
  Oropetium_20150105_06693A 184 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLQLLQRDTTGLTTEN 242
                                9***********************************************98887777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-16180244IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.887182245IPR004827Basic-leucine zipper domain
PfamPF001702.8E-9184241IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.06E-11184236No hitNo description
Gene3DG3DSA:1.20.5.1704.5E-9184239No hitNo description
CDDcd147034.31E-23185234No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MMSKDKAPML GDGGSSDGLP PQLSRASGAR PKSSTPPPEY DISHMPDFPT RNTGHRRAHS  60
EILSLPDDLD LSAPGGGDGP SLSDENDEEL FSMFLDVDKL NSSCGGLSEA EAESSSAAGG  120
GGEGAGSGQP PRPRHQHSQS MDESMSIKAE ELVGAPGMEG MSPAEAKKAV SAAKLAELAL  180
VDPKRAKRIW ANRQSAARSK ERKMRYIAEL ERKVQTLQTE ATTLSAQLQL LQRDTTGLTT  240
ENSELKIRLQ TMEQQVHLQD ALNDTLRAEV QRLKVAAGQV SNGGGGGMMN FGAMPISFGG  300
NKQMFHNNQA MQSMLATHQM QQLQLHSQAQ QPLHPQLQQQ PLHPLQAQQL QQASRELKMK  360
GPMGQWGDGK SGSTGS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008652949.11e-177PREDICTED: transcription factor RF2a-like
SwissprotQ69IL41e-154RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA0A0E0M3F01e-176A0A0E0M3F0_ORYPU; Uncharacterized protein
TrEMBLK3ZUA11e-176K3ZUA1_SETIT; Uncharacterized protein
STRINGSi030182m1e-175(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.12e-73bZIP family protein