PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_06648A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 297aa    MW: 31805 Da    PI: 10.3086
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_06648AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.44.6e-11202260563
                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                kr +r   NR++A rs +RK+++++eLe++v +L+ e ++L  ++++ + e + lk+++
  Oropetium_20150105_06648A 202 KRVKRILANRVSAARSKERKLKYMAELERRVHVLQMETSTLSAKVQREQREFEVLKTQN 260
                                899************************************************99999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-13198262IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.898200263IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-10202258No hitNo description
Gene3DG3DSA:1.20.5.1704.2E-11202259No hitNo description
PfamPF001704.2E-10202260IPR004827Basic-leucine zipper domain
CDDcd147031.42E-21203252No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MDEDCGDPER RRVFSPPGGQ GQGQPPRAPT DLFSQFQRRF SQSLFLPPMV PRLPTAASGS  60
SSAFSCYQGT PALALAVSGG GSHLARSLSQ PPFFSTSQLA PLPNSFAAPD AGAAVARSIL  120
SPGTEQGPSA LPPSGSGHRR SLSDFPFGAS GGPSRTGGGP SGGASVIFAA DLAITNGEFS  180
EAEKKKIMAN DHLVEIALSD PKRVKRILAN RVSAARSKER KLKYMAELER RVHVLQMETS  240
TLSAKVQREQ REFEVLKTQN NEMRIRVQAL EQQAQLKDGT FVFIVFQHFL SHCSLV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460540.14e-49hypothetical protein SORBIDRAFT_02g030170
TrEMBLC5X6125e-49C5X612_SORBI; Putative uncharacterized protein Sb02g030170
STRINGSb02g030170.11e-48(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP148701820
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.34e-38bZIP family protein