PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_06640A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family TCP
Protein Properties Length: 321aa    MW: 33213.2 Da    PI: 4.9836
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_06640AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP100.82.4e-3163138783
                        TCP   7 rhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                                r  ++hTkv+gR+RR+Rl a caar+  L++eLG+++d++ti WL+qq++pai ++tgt++ +a ++ +++ +    
  Oropetium_20150105_06640A  63 RYRDRHTKVEGRGRRIRLAAACAARVARLTRELGHKSDGETIRWLMQQSEPAIVAATGTGTVPAIAT-TVDGVLRLP 138
                                678********************************************************77777333.222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136923.17664118IPR017887Transcription factor TCP subgroup
PfamPF036343.1E-2565134IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGEDEDMMTF YNAAVNDTAA GVGMDATMGS SEAQGPVLPK PESALVEFLG GGLQVANPRP  60
APRYRDRHTK VEGRGRRIRL AAACAARVAR LTRELGHKSD GETIRWLMQQ SEPAIVAATG  120
TGTVPAIATT VDGVLRLPAE PPTAVSDGDQ QQPVPKRRRK LQPTHAAAAA VATAALVPAA  180
PMAYYPVAAD PLLQGSGGGS ISMSSGLAPV SAATVPPGAI PFLAIPATGP GVTGDGKMMQ  240
PTAMWMVPQQ AGAGGAANQP THYWAFPTNP ELFSNYQQQA ASNAEQVVGG GEPQYQQPAG  300
HQNREREDDD IASTDSSSEE *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1154160PKRRRKL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_06640A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803340.11e-132transcription factor PCF2-like
SwissprotA2YXQ15e-83PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH65e-83PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A2T7EUU11e-130A0A2T7EUU1_9POAL; Uncharacterized protein
STRINGPavir.Ba01284.1.p1e-115(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.25e-27TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]