PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_06298A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NAC
Protein Properties Length: 70aa    MW: 8093.46 Da    PI: 8.5022
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_06298AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM26.91.3e-081761248
                        NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                                pG++F P+ +e++  +L+ k  g+++++ ++++++++y+++P++  
  Oropetium_20150105_06298A 17 VPGVQFCPKKKEII-WFLRMKYLGRRMPV-DFFRDANVYETHPQNVT 61
                               59************.99************.99************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-91564IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MVHLEEAMVG PFADTEVPGV QFCPKKKEII WFLRMKYLGR RMPVDFFRDA NVYETHPQNV  60
TGKFTLFAN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK4AKM03e-14K4AKM0_SETIT; Uncharacterized protein