PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_06296A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NAC
Protein Properties Length: 125aa    MW: 14041 Da    PI: 7.5132
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_06296AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM26.32e-0873116348
                        NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 
                                pG+rF+P+ +e++  +L+ k  g+++++ +++ ++++y+++P++  
  Oropetium_20150105_06296A  73 PGVRFRPKKKEII-WFLRMKYLGRRMPV-DFFGDANVYEAHPQNVT 116
                                9************.99************.99************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-963119IPR003441NAC domain
PROSITE profilePS510059.8271124IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MVVAVAAPAP PAEETRRGRR RQARQCQDHE SSIAADTDSS SSSSPPLCEW EKEAWMVHLD  60
EAMAGLFADT EVPGVRFRPK KKEIIWFLRM KYLGRRMPVD FFGDANVYEA HPQNVTGKFT  120
IFAN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11724GRRRQARQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-