PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_06041A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family TCP
Protein Properties Length: 291aa    MW: 31297.7 Da    PI: 5.5492
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_06041AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP110.13.2e-34104173373
                        TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                                 ++drhski T++g RdRR+Rls+++a+ fF+Lqd+LGfdk+skt++WLl+q+kpai+ l   sss+   +
  Oropetium_20150105_06041A 104 FRTDRHSKIRTAQGVRDRRMRLSLDVARDFFALQDRLGFDKASKTVDWLLTQSKPAIDRLSAESSSHR-GS 173
                                689**********************************************************9965555.22 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.5E-33105169IPR005333Transcription factor, TCP
PROSITE profilePS5136934.922105163IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MLPYPNQHHF GFSQEPQHPN PTASFVPMVP SAAGHLDQQH FFPGGGHAGQ YFNSETLEAV  60
LIRPPHRAAS EREAAVVTAA PQAAAITRNA AVAAGHARAR KRPFRTDRHS KIRTAQGVRD  120
RRMRLSLDVA RDFFALQDRL GFDKASKTVD WLLTQSKPAI DRLSAESSSH RGSGDAAEIV  180
KEAALAAGSG GACVDKATTT RGNGASSVFM DHGCELDRLV AAAPVLGEYY YEFGEMLTAN  240
GGGEGDDDDG EYDEDGDFLD EQVDGIFEVQ ITYLLLEIRP PANKMISSSS *
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_06041A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5787127e-90KM578712.1 Imperata cylindrica isolate TK154-4 retarded palea 1 protein (rep1) gene, partial cds.
GenBankKM5787197e-90KM578719.1 Saccharum arundinaceum isolate TK165-4 retarded palea 1 protein (rep1) gene, partial cds.
GenBankKM5787207e-90KM578720.1 Saccharum arundinaceum isolate TK165-1 retarded palea 1 protein (rep1) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025804518.16e-95transcription factor TB1-like
TrEMBLA0A2S3GZP21e-93A0A2S3GZP2_9POAL; Uncharacterized protein
STRINGGRMZM2G064628_P013e-87(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40523172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18550.26e-27TCP family protein