PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_06008A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family G2-like
Protein Properties Length: 470aa    MW: 47799.2 Da    PI: 7.5601
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_06008AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.7e-32277330255
                    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Oropetium_20150105_06008A 277 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 330
                                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15274331IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28275331IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23277330IPR006447Myb domain, plants
PfamPF002498.8E-7278329IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MEASSAASPD LSLHISLPNG AAGSGPSAGR SAAVGGAGGG RGGGGGGAGG GDPWRRLNGS  60
TASTELSLSP PAEPDADALP WRHRPSSATA SSSAATTSAG GAPLMSMPML LPLDAGGGGG  120
CASAAPPIRG IPIYNGPGGF PFLPPVAGGD GHHHQQHHQK VGFYGSYHHP TTTWPSSLAS  180
TSPSPAGAPP PASFDPASAF LSPAAHHHHR MLSAASGRLN GMLTDTLRGY GGGGGVGGLA  240
GIGGHHHHHH HLHGAPPFGL GSRFMPKLPA KRSMRAPRMR WTSTLHARFV HAVELLGGHE  300
RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKSTDKPAAS SGPTDGGSGD DEFSGAGQAX  360
XXXXXXXXXP FGEHRSTSEG AASSAGGGDM DQSSVGNTGT RWSNSSRDPW VSLNSCTMDA  420
HRLVVGLSSP IENAEPCRSS SSQVSNHELS SPSLEFTLGR PDWQGADHD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-16278332357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-16278332357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-16278332357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-16278332357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13846GGRGGGGGG
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_06008A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001353566.10.0uncharacterized protein LOC100280930 isoform 1
SwissprotQ0J2351e-155ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A1E5UP770.0A0A1E5UP77_9POAL; Putative transcription factor RL9
STRINGGRMZM2G082264_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.16e-55G2-like family protein