PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_05686A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 338aa    MW: 35626.3 Da    PI: 10.0926
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_05686AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.65.4e-13282315437
                                XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvke 37 
                                ++r+rr++kNRe+A rsR+RK+a++ eLe +v e
  Oropetium_20150105_05686A 282 DRRQRRMIKNRESAARSRARKQAYTMELEAEVPE 315
                                68****************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-4279335IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.933281319IPR004827Basic-leucine zipper domain
PfamPF001701.4E-10283315IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.1E-12283316No hitNo description
SuperFamilySSF579598.04E-9283318No hitNo description
CDDcd147071.80E-18283319No hitNo description
PROSITE patternPS000360286301IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MEFKNGGSSS SSQRRHQEGA PLARQGSSVY SLTFDEFQSA LGGAAAGAGG VGGVGKDFGS  60
MNMDELLRNI WTAEETQAMA SASTAGLEAP PLQRQGSSLT LPGSLSAKTV DEVWRNLVRD  120
EPQQDGAPGG GQGQQTQQRQ STLGEMTLEE FLVKAGVVRE NNPAAHALPP MPPPRPVPVA  180
PKSAAFFGNF PGTDDAAAAA ALGFAPVGGM GNLAMGNVLM PRAAAGMGMG GGALAVQTAM  240
NQLDSGGKGY SDLSSPIEPL PYSFEGLIRR RRNVGGVEKV VDRRQRRMIK NRESAARSRA  300
RKQAYTMELE AEVPEMLKDP FGRKKRVCLR RTLTGPW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460329.11e-145hypothetical protein SORBIDRAFT_02g026570
SwissprotQ6ZDF31e-82TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLC5X2A71e-145C5X2A7_SORBI; Putative uncharacterized protein Sb02g026570
STRINGSb02g026570.11e-144(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.25e-33abscisic acid responsive element-binding factor 1