PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_05637A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family ZF-HD
Protein Properties Length: 275aa    MW: 28717.2 Da    PI: 9.2742
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_05637AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.21.5e-3156109458
                ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                                 rY+eClkNhA+ +GghavDGCgEfm++ geegt +al+CaAC+CHRnFHR+e+ 
  Oropetium_20150105_05637A  56 GRYRECLKNHAVGIGGHAVDGCGEFMAA-GEEGTLDALRCAACNCHRNFHRKESP 109
                                58*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2837110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.7E-2957107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.3E-2957108IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.75258107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.84E-21197270IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.4E-33199271IPR009057Homeodomain-like
TIGRFAMsTIGR015653.1E-26209265IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MAPLPPVLSS SYETPPQQAA GGAGFVGGGG GVASNKPLPA SEPSSRANKA PGTGGGRYRE  60
CLKNHAVGIG GHAVDGCGEF MAAGEEGTLD ALRCAACNCH RNFHRKESPT SAEGSPAAIV  120
AYGATPHQQF SPYFRTPAGY GFHHHQPLHP MAAPRPLALP STSPHTHSEP RDDGDDLSGM  180
AGPMSALGPL SGMSLGAGPS GSGGSGSGKK RFRTKFTQEQ KDRMLAFAER VGWRIQKHDE  240
AAVQQFCDEV GVKRHVLKVW MHNNKHTLGK KPQS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-282102671875ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_05637A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126171e-100CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957068.11e-126zinc-finger homeodomain protein 1
SwissprotQ6YXH51e-122ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A1E5WDK31e-131A0A1E5WDK3_9POAL; Zinc-finger homeodomain protein 1
STRINGSi032496m1e-123(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39503269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.16e-62homeobox protein 22
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]