PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_05092A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 1287aa    MW: 138146 Da    PI: 9.0608
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_05092AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.21.7e-13175235262
                                XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                                ++ +r+ r+++NRe+A+ sRqRKk ++eeLe+kvk++ +   +L ++++    e a+l+++
  Oropetium_20150105_05092A 175 EDPRRAARLMRNRESAQLSRQRKKRYVEELEDKVKSMHSVINDLNSRISFVMAENATLRQQ 235
                                66789***********************************99*******999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.1E-17174238IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.979176236IPR004827Basic-leucine zipper domain
PfamPF001706.9E-12177236IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.6E-15178236No hitNo description
SuperFamilySSF579591.19E-11178236No hitNo description
CDDcd147046.46E-19179230No hitNo description
SuperFamilySSF519052.86E-288541051IPR023753FAD/NAD(P)-binding domain
PRINTSPR004195.6E-5855877No hitNo description
Gene3DG3DSA:3.50.50.603.2E-278551053IPR023753FAD/NAD(P)-binding domain
PfamPF008901.0E-49651036IPR003953FAD-dependent oxidoreductase 2, FAD binding domain
PRINTSPR004195.6E-510221036No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0015979Biological Processphotosynthesis
GO:0055114Biological Processoxidation-reduction process
GO:0009507Cellular Componentchloroplast
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016491Molecular Functionoxidoreductase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1287 aa     Download sequence    Send to blast
MAEPALLDPT AFDLRNYPAH LFDPDLPIAG GDLPLGEFSG DGLDFDLPAD FCVDDFLLRS  60
PDRGDNDDNS REASADGSGP GTSSSASPTT SAANSAVVHG AREVEVKHED SDEGRSGRDV  120
PSWSLKRKQA SPELSSDGAK CRRSGDGELS PSASASASRA AAEGSDERGA ACEEEDPRRA  180
ARLMRNRESA QLSRQRKKRY VEELEDKVKS MHSVINDLNS RISFVMAENA TLRQQLDSGG  240
GSGPPPGVVY PPAPLPGMSF PWVPGYAMRP HGSHVPLVPI PRLKPQQVAT APKVSKRPEI  300
KKGADGKSKT KTKKVAGVSL LGLLFVALVF GAFLPGFNHS FGMRGVSDNV VFRDVGRSEA  360
SVFSVSNHGK GSKAGLNSSD VRSTDPGMMK GEANGAKQKH PPGHNSSEIL AALLYVPRNG  420
KHVKINGNLI IRSVIASEKA VAHKASEGSG DQSVKDRKET SVAIARYLSP AGKGMNQETS  480
SADAPLPQWF REGMEGSILN SGICSEVFQF DISTASASSG SIIPASSIVN SSANATQKIP  540
TPAPAGGKLK NRRIMHNEAI PLTGKTVNGT EPQSFNRTSE SSKLPNTDSK PTSSVVVSVL  600
ADPREAVLSA RASTTAPSAM ALAAAATASS LRLTPLSIPP LDLLRASPSH GLLATTTSFP  660
RPRRCGCGAV VRCAKRTGKR RYPSEKKRLE RRHKELLRQA APEEGTEGRE SGYWRLSKLA  720
VPASDDPGKD FAGVSPPLLQ AIAKAIKFPV ASMLPEEAFS VIRKSFDARK VLKEPQFVYT  780
VDMDVKKLLD MEPRTWDFIA RLEPKLGAVE YMPDESLATD LISIISVNKK GSDSQVEIRD  840
TINNGSIHCA PKKPRVAVIG SGPSGLFASL VLGELGAEVT LLERGQPVEQ RGRDIGALAV  900
RRILQSESNF CFGEGGAGTW SDGKLVTRIG RNTDGVQAVM KTLVQFGAPP NILVDGKPHL  960
GTDKLVPLLR SFRHHLTELG VTIRFNARVD DLIVEDGQVK GIVVSDPKVQ PGSVIQKLPF  1020
DAVVLAVGHS ARDTYSMLCK HNVDLSPKSF AVGLRIEHPQ ELINSIQYSE LAAEVQKGRG  1080
RIPVADYKIV KSVGDGHVEN DVNITEQSRS CYSFCMCPGG QVVLTSTNPL ELCINGMSFS  1140
RRASKWANSA LVVTVSSQDF ESFKSHGPLA GVEFQREFER RAAVMGGGNF VVPAQCVTDF  1200
ISNKLSVTSL PPSSYRLGVR PSKLHELFPP YITEALQQSI IMIEQEMPGF VSKEALLHGV  1260
EVFKLLCNRL FTSKISYEAL EFLNVR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3nlc_A4e-84715126113488Uncharacterized protein VP0956
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1686693KRLERRHK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0A9D7B10.0A0A0A9D7B1_ARUDO; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-56bZIP family protein