PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_05080A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 254aa    MW: 26329.5 Da    PI: 7.8541
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_05080AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.83.8e-4318115198
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+k+l++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq
  Oropetium_20150105_05080A  18 PCAACKFLRRKCQPDCVFAPYFPPDNPHKFVQVHRVFGASNVTKILNELQPCQREDAVNSLAYEADMRLRDPVYGCVGVISILQ 101
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallk 98 
                                ++l+ql++el+++ 
  Oropetium_20150105_05080A 102 HRLRQLQQELDHAS 115
                                *********98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.98417118IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-4318114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MITVTSPTSG GGGGAGSPCA ACKFLRRKCQ PDCVFAPYFP PDNPHKFVQV HRVFGASNVT  60
KILNELQPCQ REDAVNSLAY EADMRLRDPV YGCVGVISIL QHRLRQLQQE LDHASFELSK  120
YQQVAAAAAA VVSSGGPAPL TGFAGNMLPD STQNIMNTGH QSMAAAIGGS AGFMQHDNFA  180
TVQMLARSYD GEAATARVVG VNGGGSYEFG SSSALGGEHS GRLGQTSGAP FLKPGTARRD  240
GQSTSAQSMS SGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-54141217114LOB family transfactor Ramosa2.1
5ly0_B2e-54141217114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_05080A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962077.11e-101LOB domain-containing protein 6
RefseqXP_004962078.11e-101LOB domain-containing protein 6
RefseqXP_004962079.11e-101LOB domain-containing protein 6
RefseqXP_012700131.11e-101LOB domain-containing protein 6
SwissprotQ32SG33e-97LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLK3ZC401e-100K3ZC40_SETIT; Uncharacterized protein
STRINGSi024114m1e-101(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.45e-49LBD family protein