PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_05071A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NAC
Protein Properties Length: 393aa    MW: 42111.1 Da    PI: 7.4386
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_05071AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.66e-50451702128
                        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                                +pGfrFhPt+eel+ +yL++kvegk++++ + i+++d+y+++Pw+Lp+++  + kew+f+++rd+ky++g+r+nr+t+sgyWka
  Oropetium_20150105_05071A  45 MPGFRFHPTEEELIEFYLRRKVEGKRFNV-DLIADLDLYRFDPWELPAMAVMGGKEWFFYVPRDRKYRNGDRPNRVTASGYWKA 127
                                79***************************.99***************7767789****************************** PP

                        NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                tg d+ +  ++++ +glkktLvfy+g+apkg++++W+m+eyrl
  Oropetium_20150105_05071A 128 TGADRMIRGENSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 170
                                *****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-5744194IPR003441NAC domain
PROSITE profilePS5100555.42644194IPR003441NAC domain
PfamPF023651.2E-2446170IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MSTDLEDGHG TAGSVAAAGG TAGSGEASVG GGEAPGDSHD NDLVMPGFRF HPTEEELIEF  60
YLRRKVEGKR FNVDLIADLD LYRFDPWELP AMAVMGGKEW FFYVPRDRKY RNGDRPNRVT  120
ASGYWKATGA DRMIRGENSR PIGLKKTLVF YSGKAPKGVR SSWIMNEYRL PPPPAEADPL  180
AAKSEISLCR VYKRSGIDDG HRHGQSSSSN QASSSGRRTR VGRHVSSPSS STPPLLPPIQ  240
HPSSRFHLLQ GDCSSSASPP AIMDQVITAA HNVPQLLQPQ TLAPPPSSGN SLVAALAPTE  300
GATALASTYS LLDLGMGSSR PSVDELSTLV GHSQAYASHL SAATDSHFLP LPSPQPMPQM  360
APPLSSVPDR LSWDWNPVPE TAVRGYNTSS FK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-554619519166NAC domain-containing protein 19
4dul_A2e-554619519166NAC domain-containing protein 19
1ut7_B2e-554619519166NO APICAL MERISTEM PROTEIN
1ut7_A2e-554619519166NO APICAL MERISTEM PROTEIN
1ut4_B2e-554619519166NO APICAL MERISTEM PROTEIN
1ut4_A2e-554619519166NO APICAL MERISTEM PROTEIN
3swp_D3e-554619522169NAC domain-containing protein 19
3swp_C3e-554619522169NAC domain-containing protein 19
3swp_B3e-554619522169NAC domain-containing protein 19
3swp_A3e-554619522169NAC domain-containing protein 19
3swm_D3e-554619522169NAC domain-containing protein 19
3swm_C3e-554619522169NAC domain-containing protein 19
3swm_B3e-554619522169NAC domain-containing protein 19
3swm_A3e-554619522169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962060.11e-157PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLK3Z6L91e-157K3Z6L9_SETIT; Uncharacterized protein
STRINGSi022103m1e-156(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.28e-90NAC domain containing protein 35