PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_05058A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NAC
Protein Properties Length: 329aa    MW: 35641.2 Da    PI: 8.8589
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_05058AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.53.7e-51251491128
                        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                                lppGfrFhPtdeelv++yL+++++g ++++  +i+e+d+yk++PwdLp+++  +ekewyfFs+rd+ky++g+r+nra+ +gyWk
  Oropetium_20150105_05058A  25 LPPGFRFHPTDEELVMHYLCRRCAGLPISV-PIIAEIDLYKYDPWDLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWK 107
                                79****************************.88***************7666789***************************** PP

                        NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                atg dk+v +   + v +kk Lvfy g+apkg kt+W+mheyrl
  Oropetium_20150105_05058A 108 ATGADKPVGT--PKPVAIKKALVFYAGKAPKGDKTNWIMHEYRL 149
                                ********98..789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-6120177IPR003441NAC domain
PROSITE profilePS5100559.45925177IPR003441NAC domain
PfamPF023655.0E-2626149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MSGGTRGPAA AAAAAQGQTH EELQLPPGFR FHPTDEELVM HYLCRRCAGL PISVPIIAEI  60
DLYKYDPWDL PRMALYGEKE WYFFSPRDRK YPNGSRPNRA AGTGYWKATG ADKPVGTPKP  120
VAIKKALVFY AGKAPKGDKT NWIMHEYRLA DVDRSAARKK NNSLRLDDWV LCRIYNKKSA  180
SERPAPAGWD HAASEQQHPA AAKAHSPPEQ KPSLLLPPGP GRTTACYAPP PFPELAAYHE  240
VRPTSDSVPR AHGTDSSCSG HATSAERPEV QSQPKIDEWE RTFASSAAAP GVNPAGSMLG  300
GPLGPAAGLS AGDPLFHDIL TYWGNKPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-812218312174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3769310.0AK376931.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3144G06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001136644.11e-168putative NAC domain transcription factor superfamily protein
SwissprotQ7F2L31e-135NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBLB4FJN51e-168B4FJN5_MAIZE; NAC protein
STRINGGRMZM2G180328_P011e-167(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34173782
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-118NAC family protein