PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_04992A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 243aa    MW: 25738 Da    PI: 9.6204
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_04992AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.51.5e-13163214556
                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                                +r++r++kNRe+A rsR RK+a+++eLe  v +Le+e  +L  e ee +++ 
  Oropetium_20150105_04992A 163 QRQKRMIKNRESAARSRDRKQAYVAELESQVSQLEEEQAELLREQEEQNQKR 214
                                89************************************99997777665554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.3E-8159221IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.611161213IPR004827Basic-leucine zipper domain
PfamPF001701.2E-11162213IPR004827Basic-leucine zipper domain
CDDcd147071.81E-16163210No hitNo description
SuperFamilySSF579599.14E-11163212No hitNo description
Gene3DG3DSA:1.20.5.1708.7E-13164217No hitNo description
PROSITE patternPS000360166181IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MASSRVASSQ PQAAGSSDLA RFRSGSGIGS MNMDDIMRNI YGEAPPPAAA GGPVEPVPAA  60
APGPAVVRRT SEEVWNEISA AGGLSAPALP LPPPAAAAVA AAGGGAAEMT LEDFLARDTG  120
AARAPGVEGA MVLSFPDGDV IGVGGGRARK RAHVDPTDRA VVQRQKRMIK NRESAARSRD  180
RKQAYVAELE SQVSQLEEEQ AELLREQEEQ NQKRLKELME KPVPTIRRKP LQDLRRTSSW  240
KW*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00648PBMTransfer from LOC_Os05g36160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961953.14e-85PREDICTED: G-box-binding factor 4-like
SwissprotP427773e-25GBF4_ARATH; G-box-binding factor 4
TrEMBLB6TGZ06e-85B6TGZ0_MAIZE; G-box-binding factor 4
STRINGGRMZM2G132868_P012e-84(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.11e-14bZIP family protein