PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_04390A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GRF
Protein Properties Length: 395aa    MW: 42956 Da    PI: 8.7874
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_04390AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.99.6e-2590133144
                        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                                d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  Oropetium_20150105_04390A  90 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 133
                                79***************************************998 PP

2QLQ57.44.4e-201953236
                        QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                               +FTa+Q+q+L++Q+l+yK+La+++P+P++L+ +++
  Oropetium_20150105_04390A 19 PFTATQWQELEHQALIYKCLASGKPIPAYLMPPLR 53
                               9******************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.7E-111854IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.2691954IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.2E-141951IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.57390134IPR014977WRC domain
PfamPF088792.1E-2091133IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MMMMSNRAGA GAGGTGRYPF TATQWQELEH QALIYKCLAS GKPIPAYLMP PLRRILDTAL  60
TTSPSLAFPP QPSLGWGCYG MGFGRKADED PEPGRCRRTD GKKWRCSKEA YPDSKYCEKH  120
MHRGKNRSRK PVEMSLTTPA PPSSTNNATT TAPPAASSPV PTYHRAAAAA PYNALYGGGG  180
GSPYAAAHHA KAVSPFHLHL ETTHPHPPPS SSNYSSAVQW DYAYGHPANK EVVGEHAFFS  240
DGGAAERSHR NQWQFKELGG MEPTKQSATS LFPDSGGYGN GSFAIDTSVT KEDEEEERRR  300
QQQQHCFVLG ADLRLERPSS NHHHDVPAAA QQKPLRPFFD EWPHEKSGKG GSWMGLGGET  360
TQLSMSIPMA ANDIPVTSRY RNGVLTALRC ASLH*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_04390A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9702921e-143EU970292.1 Zea mays clone 343148 atGRF5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701613.11e-166growth-regulating factor 1 isoform X2
SwissprotQ6AWY81e-143GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLA0A059Q1H01e-170A0A059Q1H0_9POAL; Growth-regulating factor
STRINGPavir.J03212.1.p1e-170(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-50growth-regulating factor 5