PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_03379A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 326aa    MW: 35130.4 Da    PI: 7.4149
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_03379AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1513.1e-16255301552
                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                                +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lkk+ +el
  Oropetium_20150105_03379A 255 RRQKRMIKNRESAARSRARKQAYTNELENKVSHLEEENERLKKQ-KEL 301
                                69***************************************965.333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.7E-16249299No hitNo description
SMARTSM003382.1E-12251323IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.622253298IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.19E-12255300No hitNo description
PfamPF001704.9E-14255298IPR004827Basic-leucine zipper domain
CDDcd147073.98E-26255302No hitNo description
PROSITE patternPS000360258273IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MASKAGGGDA GSAQGGNGPG GLARQGSLYN LTLNEVQSHL AEPLLSMNLD ELLKSVFPDG  60
TDPSGSTAGK PELTSGLQRQ GSITMPPQLS KKTVDEVWRG IQDRPEISAK EGGQWRRERQ  120
PTLGEMTLED FLVRAGVVTE GCASMKDSNN VPTNVDTIGS SVVAGGAPSL NPRVQWLQQY  180
QQQALEPQQP SLADPYMANQ LAAPQPLSIA TGAILDSIYP DGQITSPVLS AFSDPQTPGR  240
KRGAPGVVTD KVIERRQKRM IKNRESAARS RARKQAYTNE LENKVSHLEE ENERLKKQKE  300
LDELLCSASS PEPKYQLRRA NSATF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439989.11e-159hypothetical protein SORBIDRAFT_09g023920
SwissprotQ9LES31e-75AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLC5YZX91e-159C5YZX9_SORBI; Putative uncharacterized protein Sb09g023920
STRINGSb09g023920.11e-159(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.12e-72ABA-responsive element binding protein 3