PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_03274A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 174aa    MW: 18300.5 Da    PI: 8.6509
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_03274AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.93.5e-1695152562
                                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                                ++++r++kNRe+A rsR+RK+a+++eLe++v  L +eN +Lk + ++lk e+a+l ++
  Oropetium_20150105_03274A  95 RKTIRMMKNRESALRSRARKRAYVQELEKEVRRLVNENLKLKRQCKQLKVEMAALIQS 152
                                789**********************************************999988665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.2E-1690150No hitNo description
SMARTSM003381.0E-1391155IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.63493149IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.5E-1295150No hitNo description
PfamPF001706.1E-1395149IPR004827Basic-leucine zipper domain
CDDcd147073.02E-1595149No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MSSSPQLSLS GCSSLFSLSS SSTGRDNDGA AAAPAMPPLP PRRPPLLSLS VGGGGGCDDE  60
DEEEGQEYLP GSLDLQLMGG GGGGGGSSCD GDDERKTIRM MKNRESALRS RARKRAYVQE  120
LEKEVRRLVN ENLKLKRQCK QLKVEMAALI QSSSSGSSKS AHNIRRTSSS AQL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0610861e-53AK061086.1 Oryza sativa Japonica Group cDNA clone:006-206-G05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961973.14e-47PREDICTED: protein FD-like
TrEMBLA0A0A9PEK13e-48A0A0A9PEK1_ARUDO; Uncharacterized protein
STRINGSi023448m1e-46(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.11e-13bZIP family protein