PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_02287A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family G2-like
Protein Properties Length: 328aa    MW: 33997.2 Da    PI: 10.9444
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_02287AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.24.4e-29260309251
                    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Oropetium_20150105_02287A 260 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 309
                                9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.02E-13257312IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-25258310IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-21260310IPR006447Myb domain, plants
PfamPF002491.5E-5261309IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MEAAASAPDL SLHISLPSSN AAGPPSSSAP GLAAGVAAGR GAAAAGGGDP WRWLNGSTAS  60
TELSLSPPPP PRMELGGAGA LLPPWRLRPP TVAANNNSPS SNSSSTAAFL PVTVPRLSLD  120
AATAVEAARA RPINGVPVYS SSPAAAAGSG GFLGAAAGDY RQRHHPKAGL YNPYHPSSAA  180
WPSSLRSSAS TTPASVDHSF LSPSAYHRML SGTGRLHLHA ADTLRAGYGG NQHQHFGGSL  240
ASSRFYMPRL PASRRGMRAP RMRWTSTLHA RFVHAVELLG GHERATPKSV LELMDVKDLT  300
LAHVKSHLQA RYLSTLLPPN VSDREEH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-14261312459Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-14261312459Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-14261312358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-14261312358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-14261312358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-14261312358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-14261312459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-14261312459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-14261312459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-14261312459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-14261312459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-14261312459Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_02287A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2865281e-91DQ286528.1 Zea mays KANADI1-like protein (kan1b) mRNA, partial cds.
GenBankEU9350031e-91EU935003.1 Zea mays cultivar B73 kanadi1 (kan1) mRNA, complete cds.
GenBankJX4699821e-91JX469982.1 Zea mays subsp. mays clone UT3342 G2-like transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025820100.14e-98probable transcription factor RL9 isoform X2
SwissprotQ0J2351e-43ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A3L6RKZ81e-105A0A3L6RKZ8_PANMI; Putative transcription factor RL9
STRINGPavir.Fb00812.1.p1e-101(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.15e-34G2-like family protein