PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_02255A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family TCP
Protein Properties Length: 205aa    MW: 22516.5 Da    PI: 7.8855
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_02255AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP109.16.6e-3438105370
                        TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                                 ++drhski T++g RdRR+Rls+ +a+ fF+Lqd+LGfdk+skt++WLl+q+kpai+ l +  + +a
  Oropetium_20150105_02255A  38 LRTDRHSKIRTAQGVRDRRMRLSVGVARDFFALQDRLGFDKASKTVNWLLTQSKPAIDRLCDAAAAPA 105
                                689*********************************************************99955555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.7E-3239113IPR005333Transcription factor, TCP
PROSITE profilePS5136933.7453997IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
QQDQAVVQQQ QDGVPLLLAA VDDDGAARAA AVTRRRPLRT DRHSKIRTAQ GVRDRRMRLS  60
VGVARDFFAL QDRLGFDKAS KTVNWLLTQS KPAIDRLCDA AAAPAGGPPL VKKGKGDVNS  120
TSTGCCLKDT RERVMRSRGP LDAPVAALME MEDRHGCELD WNMSEAVAAT ELTTQPMDDR  180
LEYDHYHQLE ELIVRCNNGG VLPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A5e-134497154Putative transcription factor PCF6
5zkt_B5e-134497154Putative transcription factor PCF6
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_02255A
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0634576e-71BT063457.1 Zea mays full-length cDNA clone ZM_BFc0065H12 mRNA, complete cds.
GenBankEU9756366e-71EU975636.1 Zea mays clone 494952 teosinte branched1 protein mRNA, complete cds.
GenBankKJ7268966e-71KJ726896.1 Zea mays clone pUT3439 TCP transcription factor (TCP15) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973503.24e-61transcription factor TB1
TrEMBLK3YLV47e-61K3YLV4_SETIT; Uncharacterized protein
STRINGSi015230m1e-61(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40523172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.25e-23TCP family protein