PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_02230A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family ZF-HD
Protein Properties Length: 125aa    MW: 13266 Da    PI: 8.2179
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_02230AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer81.69.1e-262983358
                ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                               +vrY eC++NhAa++GghavDGC+Ef+++ geegt  a++Ca CgCHR+FHRr v+
  Oropetium_20150105_02230A 29 GVRYCECRRNHAARMGGHAVDGCREFLAA-GEEGTGGAFRCATCGCHRSFHRRVVQ 83
                               69**************************9.999********************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-172883IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047707.3E-263082IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.4E-213180IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.5893281IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MKRLVMLRRC HAPPPPAVVF GGRCCVGAGV RYCECRRNHA ARMGGHAVDG CREFLAAGEE  60
GTGGAFRCAT CGCHRSFHRR VVQRCCSCFC RDDEDTDAHA AAAARGRWDD CSPAESTASG  120
TTAS*
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_02230A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1079043e-47AK107904.1 Oryza sativa Japonica Group cDNA clone:002-134-F11, full insert sequence.
GenBankAP0051593e-47AP005159.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0016C11.
GenBankAP0149643e-47AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126163e-47CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBankCT8314433e-47CT831443.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA034C07, full insert sequence.
GenBankCT8314443e-47CT831444.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA001I02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151712.23e-41mini zinc finger 3
SwissprotQ0J5F82e-33MIF4_ORYSJ; Mini zinc finger protein 4
TrEMBLB6U4042e-45B6U404_MAIZE; Mini zinc finger 3
STRINGOGLUM08G16680.11e-31(Oryza glumipatula)
STRINGGRMZM2G370863_P012e-32(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.14e-24mini zinc finger 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]