PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_01593A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GRF
Protein Properties Length: 377aa    MW: 40942.6 Da    PI: 8.4388
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_01593AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.82.2e-24115158245
                        WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                 epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Oropetium_20150105_01593A 115 LEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVEP 158
                                69***************************************997 PP

2QLQ58.61.9e-205994237
                        QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                               +FT+aQ ++L++Q+l+yKyL+a++P+P++Ll++i++
  Oropetium_20150105_01593A 59 PFTPAQYEELERQALIYKYLLAGVPIPQDLLLPIRR 94
                               9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.1E-125894IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.2E-145993IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.0575994IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.849114158IPR014977WRC domain
PfamPF088797.6E-21116157IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MAMPFASLSP AADHRPSATS FPPFCRACPP SPPLSAVGED AQQQQQQNDM RGRWAAAPPF  60
TPAQYEELER QALIYKYLLA GVPIPQDLLL PIRRGYAYHQ PALGYGPYFG KKVDLEPGRC  120
RRTDGKKWRC SKEAAPDSKY CERHMHRGRN RSRKPVEPQL VAAPLSSQPT QAPGNNLAGV  180
FQNNTLYPAI AGSRGGGGGA TGTFGLGSTA QLHMDNAAPY AIAAGCGSKD LRYSTYGMRT  240
LAAEYSQQTS GGMDSSIENS WRLQPSQPTT YQVSSYPLYG TLSGLDESTI CSLPKTEREP  300
VSFFGSDLSF ANSAKQENQT LRPFFDEWPK SRDSWSELAD DNSLSSFSAT QLSISIPMGT  360
SDFNTGSRSP QGIQSR*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_01593A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF5158451e-125EF515845.1 Zea mays putative growth-regulating factor 6 (GRF6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976689.11e-177growth-regulating factor 3
SwissprotQ6AWY61e-173GRF3_ORYSJ; Growth-regulating factor 3
TrEMBLA0A0D9W8Z61e-176A0A0D9W8Z6_9ORYZ; Uncharacterized protein
STRINGLPERR04G19760.11e-177(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.15e-43growth-regulating factor 5