PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_01574A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LFY
Protein Properties Length: 385aa    MW: 41992.8 Da    PI: 8.3699
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_01574AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY523.21.1e-15913731385
                    FLO_LFY   1 mdpea.fsas.lfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmk 82 
                                mdp++ fsa+  f+wd       ppa++                 a  + rele+l+ +yGvr +tva+i+elGft+stL++m+
  Oropetium_20150105_01574A   1 MDPNDaFSAAhPFRWDLG-----PPAHAXXXXXXXXXX--XXXLLAPPASRELEDLVAGYGVRPSTVARISELGFTASTLLGMT 77 
                                777654776559****63.....333443333333333..34455556689********************************* PP

                    FLO_LFY  83 deelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsgge 166
                                ++eldd+m++l+ +fr+d+++Ger+G++aa+raer r+++      r      ++ ++lda+sqe+ls+e++      agsgg+
  Oropetium_20150105_01574A  78 ERELDDMMAALTGLFRWDVMLGERFGLRAALRAERGRVTSLG-GGPRF-----QNGSSLDAASQEVLSDERDV-----AGSGGM 150
                                ***************************************977.33343.....46789***********9874.....566555 PP

                    FLO_LFY 167 glgeaelvaaeekkseeekkkaskkkqkrkkkkelkse.......ededeeeeededeegsgedgeerqrehPfivtepgevar 243
                                   e++     + k++++k  a+++k                   ede+e+  +d+ e+++g  g erqrehPf+vtepgevar
  Oropetium_20150105_01574A 151 ADDETGGRRLMAGKKQANKGGATTRKGXXXXXXX---XxxpldvlEDENEDLGSDSTESSAGGVGGERQREHPFVVTEPGEVAR 231
                                5555444444433333333333222222222222...122455668888888889999999999******************** PP

                    FLO_LFY 244 gkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafk 327
                                +kknGLDYLf+LyeqCr fLlqvq+iak  G+k+Ptkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLd easnalrra+k
  Oropetium_20150105_01574A 232 AKKNGLDYLFHLYEQCRVFLLQVQTIAKMGGHKSPTKVTNQVFRYAKKCGASYINKPKMRHYVHCYALHCLDAEASNALRRAYK 315
                                ************************************************************************************ PP

                    FLO_LFY 328 ergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                                +rgenvGawrqacy+plv+iaar+g+didavf+ahprLsiWYvPt+LrqLCh++r  +
  Oropetium_20150105_01574A 316 ARGENVGAWRQACYAPLVEIAARHGFDIDAVFAAHPRLSIWYVPTRLRQLCHQARGGH 373
                                ******************************************************9766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016987.8E-1741373IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MDPNDAFSAA HPFRWDLGPP AHAXXXXXXX XXXXXXLLAP PASRELEDLV AGYGVRPSTV  60
ARISELGFTA STLLGMTERE LDDMMAALTG LFRWDVMLGE RFGLRAALRA ERGRVTSLGG  120
GPRFQNGSSL DAASQEVLSD ERDVAGSGGM ADDETGGRRL MAGKKQANKG GATTRKGXXX  180
XXXXXXXPLD VLEDENEDLG SDSTESSAGG VGGERQREHP FVVTEPGEVA RAKKNGLDYL  240
FHLYEQCRVF LLQVQTIAKM GGHKSPTKVT NQVFRYAKKC GASYINKPKM RHYVHCYALH  300
CLDAEASNAL RRAYKARGEN VGAWRQACYA PLVEIAARHG FDIDAVFAAH PRLSIWYVPT  360
RLRQLCHQAR GGHAAAGLPP PPMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1002113701160PROTEIN LEAFY
2vy2_A1e-1002113701160PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_01574A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976675.10.0probable transcription factor FL
SwissprotQ0JAI10.0FL_ORYSJ; Probable transcription factor FL
TrEMBLA0A1E5W6A30.0A0A1E5W6A3_9POAL; Putative transcription factor FL
STRINGSi011756m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-116floral meristem identity control protein LEAFY (LFY)