PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_01470A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family GRAS
Protein Properties Length: 627aa    MW: 65591.2 Da    PI: 8.0988
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_01470AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS308.61.5e-942616262374
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                                ++lL e+A a+++g+ e a + La+l+  a+++gd  qRl+a+++ AL++r+a+    +++a +++      s+e+ +  ++++
  Oropetium_20150105_01470A 261 RQLLSEAAVAIADGNVETAATHLATLKRAANSRGDVEQRLIAMMVAALSSRIAS----TASAAHAELC----SAEHRTGSQVLH 336
                                789**************************************************9....3333333333....5677777799** PP

                       GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg....skeeleetger 164
                                + sP+++++  +a  aI eav +++ vH +Dfdis + Q +aL+q La+R+  g  sl++T+v +p+s      + +l ++ger
  Oropetium_20150105_01470A 337 DRSPCFRLALHAASVAIAEAVGNHRSVHLVDFDISVP-QHAALIQYLADRRvPGGTSLKVTAVTDPTSPftqsLAASLPAVGER 419
                                ***********************************98.99********99955667*********99888877788999***** PP

                       GRAS 165 LakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh 248
                                L+k+Ae+ gv+ +f+v v+ r ++l+ ++L ++pgEalaVnl+++l +++desvs +++rde+L+ v+ l P+vv++veqe+++
  Oropetium_20150105_01470A 420 LKKLAERAGVEYRFKV-VVCRAAELDASKLGCEPGEALAVNLAFALSHVPDESVSPANPRDELLRRVRALGPQVVTLVEQELNT 502
                                ***************9.688899************************************************************* PP

                       GRAS 249 nsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsek 332
                                n++++++rf++a+ +y a++dslea+l+r+s er++ E++ l++++ n+v  eg +r er+e ++kWr+r+++aGF+pvpls +
  Oropetium_20150105_01470A 503 NTAPLAARFTDACAHYGAILDSLEATLGRDSAERAMAEAA-LAKKAANAVGREGPDRLERCEVFGKWRARFGMAGFRPVPLSPS 585
                                ***************************************9.9****************************************** PP

                       GRAS 333 aakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                +a+q+ + +   +  g+ ++ ++g l +gW++r ++++SaWr
  Oropetium_20150105_01470A 586 IADQVVARVGPAP-PGFAMKTDNGVLRFGWMGRVVTVASAWR 626
                                ************9.9**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.57234607IPR005202Transcription factor GRAS
PfamPF035145.1E-92261626IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MEPGAPWRDP SRQGYAYGLG SAMQIPLLQQ QQQRPDTGGV LKRSLGELER WQHHQQQQVA  60
AQQALYLRAV RQRTAAAADI AALLGGAPSQ HNTTMILPGS SYGGALASPS STLSSLTTAS  120
RAVPLVQPQM QRQVPPPLMA SSTQQTQALG VSRAAPPPPA AAASSDLFLL QELEKQLLGD  180
DDEPPVAAMS GTGSAVTNSE WEETIQQLNS ITAAPSPGLL PAAATTPNNA GMTRSPSNSS  240
SSTASSSASC SPPTPGSAAT RQLLSEAAVA IADGNVETAA THLATLKRAA NSRGDVEQRL  300
IAMMVAALSS RIASTASAAH AELCSAEHRT GSQVLHDRSP CFRLALHAAS VAIAEAVGNH  360
RSVHLVDFDI SVPQHAALIQ YLADRRVPGG TSLKVTAVTD PTSPFTQSLA ASLPAVGERL  420
KKLAERAGVE YRFKVVVCRA AELDASKLGC EPGEALAVNL AFALSHVPDE SVSPANPRDE  480
LLRRVRALGP QVVTLVEQEL NTNTAPLAAR FTDACAHYGA ILDSLEATLG RDSAERAMAE  540
AALAKKAANA VGREGPDRLE RCEVFGKWRA RFGMAGFRPV PLSPSIADQV VARVGPAPPG  600
FAMKTDNGVL RFGWMGRVVT VASAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4027962622375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580377.10.0PREDICTED: scarecrow-like protein 8
TrEMBLK7UKW80.0K7UKW8_MAIZE; Uncharacterized protein
STRINGGRMZM2G173429_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.13e-94SCARECROW-like 8