PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_01257A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 316aa    MW: 33894.4 Da    PI: 6.4294
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_01257AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.37.7e-091271661352
                                HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1  13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                                NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  Oropetium_20150105_01257A 127 NRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLF 166
                                *********************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579592.39E-9124170No hitNo description
CDDcd147039.11E-20124169No hitNo description
SMARTSM003385.7E-6125179IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-9126173No hitNo description
PfamPF001706.4E-7126167IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.025127180IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MQQPEAADPP GRAAFPPLPT AARPGSHHRR ARSEVAFRLL DDLDLGGGGG PGGDGLDEIG  60
SEDDLFSTFM DIEKISAAGP TAGSDRDRAA ESSSPPRPKH RHSSSVDGSG LFFSPGSGGG  120
SAAILANRQS AARSKERKAR YITELERKVQ TLQTEATTLS AQLTLFQRDT TGLSTENAEL  180
KIRLQAMEQQ AQLRDALNDA LKQELERLKL ATGEVTNSNE TYNMRFQHVP YNSSFFPLSQ  240
QNTAHRQGGA QLAPAFPPPH PNVPNHQMLS HPNTLQDIMQ QDSIGRFQGL DIGKGPLVVK  300
SESSSISASE SSSNF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984459.11e-145PREDICTED: transcription factor RF2b
SwissprotQ6S4P41e-144RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0A9NWC61e-157A0A0A9NWC6_ARUDO; Uncharacterized protein
STRINGSi036380m1e-144(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.12e-57bZIP family protein