PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_01204A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family NAC
Protein Properties Length: 401aa    MW: 45189.9 Da    PI: 9.2697
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_01204AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM139.91.5e-434315021129
                        NAM  21 kkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkk 104
                                +k+ +++++   vi evd++k+ePwdLp k+k +ekewyfF+++d+ky+tg+r+nrat+sgyWkatgkdke+++ +g lvg+kk
  Oropetium_20150105_01204A  43 PKALDRHFSS-GVIGEVDLNKCEPWDLPGKAKMGEKEWYFFCHKDRKYPTGTRTNRATESGYWKATGKDKEIFRGRGVLVGMKK 125
                                5666666666.79***************99999*************************************************** PP

                        NAM 105 tLvfykgrapkgektdWvmheyrle 129
                                tLvfy+grap+g+kt Wvmhe+rle
  Oropetium_20150105_01204A 126 TLVFYRGRAPRGTKTGWVMHEFRLE 150
                                **********************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.18E-4616159IPR003441NAC domain
PROSITE profilePS5100545.55923220IPR003441NAC domain
PfamPF023655.0E-1765149IPR003441NAC domain
SuperFamilySSF1019411.18E-46208220IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MSEVSVINQV EVEDHAAAGQ LDLPPGFRXX XXXXXXXXXX XTPKALDRHF SSGVIGEVDL  60
NKCEPWDLPG KAKMGEKEWY FFCHKDRKYP TGTRTNRATE SGYWKATGKD KEIFRGRGVL  120
VGMKKTLVFY RGRAPRGTKT GWVMHEFRLE GRLPHPLPRS AKVRLRLLVA LRNFPFWFFF  180
FFFFFWWGGG GGELKNPLRF LIDVAVDVQD EWAVCKVFNK ELAARTEPXX XXXXXXXXXX  240
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXFKGLAST SGGHVADTAP ASNYLPVKME  300
GQFPHQQALP MFYSGSSGPY FSLPAANTGD VPAAIRRYCR EKQEASGQTT SVLSPSRETG  360
LSTDRNAGGA EISSAATSHH PFLHEELDDP VLNVADIWKY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-40121499145NAC domain-containing protein 19
3swm_B1e-40121499145NAC domain-containing protein 19
3swm_C1e-40121499145NAC domain-containing protein 19
3swm_D1e-40121499145NAC domain-containing protein 19
3swp_A1e-40121499145NAC domain-containing protein 19
3swp_B1e-40121499145NAC domain-containing protein 19
3swp_C1e-40121499145NAC domain-containing protein 19
3swp_D1e-40121499145NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984514.11e-145PREDICTED: NAC domain-containing protein 92-like
TrEMBLK4A9T31e-143K4A9T3_SETIT; Uncharacterized protein
STRINGSi035639m1e-143(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.23e-66Arabidopsis NAC domain containing protein 87