PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_01099A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family bZIP
Protein Properties Length: 168aa    MW: 17974.6 Da    PI: 8.1023
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_01099AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.21.7e-082776352
                               XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                     bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52
                               e +r  r+ +NR++Ar+sR ++++ +eeL+  +  L  eN+a +  ++  
  Oropetium_20150105_01099A 27 EERRRNRMTSNRLSARKSRMKRQQHVEELTALAYLLGRENEAARAGVDGA 76
                               567889**********************************9877766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-92589IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.8E-82596No hitNo description
PROSITE profilePS502179.0132790IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.25E-72983No hitNo description
CDDcd147027.03E-133081No hitNo description
PROSITE patternPS0003603347IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MAPQAAPAAA QHQGTPHRRA AAAVTEEERR RNRMTSNRLS ARKSRMKRQQ HVEELTALAY  60
LLGRENEAAR AGVDGALRRC RLLEQENLVL AAHARQLCAA LALSNSQLRM LGTVAGVPLD  120
VPGVPDHLMQ LYGGDCLQIP MLSWPDATVD AADVGAMLGL AGDPDLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004987029.16e-60PREDICTED: bZIP transcription factor 53-like
TrEMBLK4ALW07e-60K4ALW0_SETIT; Uncharacterized protein
STRINGSi039895m2e-59(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125042837
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.12e-10basic region/leucine zipper motif 53