PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_00507A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family YABBY
Protein Properties Length: 189aa    MW: 21042.3 Da    PI: 8.8804
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_00507AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY61.24.4e-19156156
                      YABBY  1 advfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasql 56
                               +d++  se++Cyv+C+fCnt+lav vP + l+ +vtv+CGhC +l  ++l+  + +
  Oropetium_20150105_00507A  1 MDLVAPSEHLCYVRCTFCNTVLAVGVPCKRLMDTVTVKCGHCNNLSYLSLRPPMVQ 56
                               578899**************************************988877765555 PP

2YABBY90.63.9e-2887145104162
                      YABBY 104 nedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWah 162
                                 + e  +rvp v++PPek+ r Psaynrf++eeiqrika+ Pdi hreafs+aaknWa 
  Oropetium_20150105_00507A  87 TSAEVNARVPFVVKPPEKKHRLPSAYNRFMREEIQRIKAAKPDIPHREAFSMAAKNWAK 145
                                45667789999***********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046905.7E-476146IPR006780YABBY protein
SuperFamilySSF470951.22E-889147IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.8E-5100147IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MDLVAPSEHL CYVRCTFCNT VLAVGVPCKR LMDTVTVKCG HCNNLSYLSL RPPMVQPPSP  60
TDHPLAPFQG PCNDCRRNQP LGLPSPTSAE VNARVPFVVK PPEKKHRLPS AYNRFMREEI  120
QRIKAAKPDI PHREAFSMAA KNWAKCDPRC STTVSTATSN SAPEPRVERA KEQVVESFDI  180
FKQIERSI*
Functional Description ? help Back to Top
Source Description
UniProtRegulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_00507A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4702681e-155AB470268.1 Sorghum bicolor SbDL mRNA for DL related protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797474.11e-122protein DROOPING LEAF isoform X2
SwissprotQ76EJ01e-110YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBLA0A3L6TQ501e-121A0A3L6TQ50_PANMI; Protein DROOPING LEAF isoform X1
STRINGPavir.Ib00755.1.p1e-120(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59513657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.14e-52YABBY family protein