PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_00326A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family HD-ZIP
Protein Properties Length: 329aa    MW: 35994.2 Da    PI: 4.5819
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_00326AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.8e-1870121556
                                SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                   Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                +++  +q+++Le+ Fe +++++ +++ ++A+ lgL+ rqV vWFqNrRa++k
  Oropetium_20150105_00326A  70 RRLALDQVRALERNFETDNKLDPDRKVRIARDLGLQPRQVAVWFQNRRARWK 121
                                467789*********************************************9 PP

2HD-ZIP_I/II127.27.3e-4167159193
                HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekev 84 
                                ekkrrl+ +qv++LE++Fe+++kL+p+rKv++ar+LglqprqvavWFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++
  Oropetium_20150105_00326A  67 EKKRRLALDQVRALERNFETDNKLDPDRKVRIARDLGLQPRQVAVWFQNRRARWKTKQLERDFAALRARHDALRADCDALRRDK 150
                                69********************************************************************************** PP

                HD-ZIP_I/II  85 eeLreelke 93 
                                ++L++e++e
  Oropetium_20150105_00326A 151 DALAAEIRE 159
                                ****99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.4E-1858125IPR009057Homeodomain-like
SMARTSM003893.4E-1866127IPR001356Homeobox domain
PROSITE profilePS5007116.30967123IPR001356Homeobox domain
CDDcd000861.56E-1668124No hitNo description
PfamPF000461.0E-1569121IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-1975122IPR009057Homeodomain-like
PRINTSPR000317.4E-594103IPR000047Helix-turn-helix motif
PROSITE patternPS00027098121IPR017970Homeobox, conserved site
PRINTSPR000317.4E-5103119IPR000047Helix-turn-helix motif
PfamPF021832.0E-15123164IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MKKQSKRPTS THESTEPGDN KLAFPEEKDL TAQDMEHDHE ETEMDDDDED ELPGGRAAQS  60
SSCGLGEKKR RLALDQVRAL ERNFETDNKL DPDRKVRIAR DLGLQPRQVA VWFQNRRARW  120
KTKQLERDFA ALRARHDALR ADCDALRRDK DALAAEIREL KQKLSKPETA VKLEAASNND  180
AAAEDRQATV VRTSAPAFYK DGSSDSDSSV VFNNDVEASP YSSAVFEPQA PAGFVGGFGG  240
SFMVDSAAAV AMGCSSSLPS FEAKWQQHGS TYPSCDSYRA GSYGGFTEEW LAGSDVISND  300
DGTAGFFSDD HASSLNFSWC ANGADGWD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115123RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOropetium_20150105_00326A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0601191e-104AK060119.1 Oryza sativa Japonica Group cDNA clone:006-308-F01, full insert sequence.
GenBankAK1015221e-104AK101522.1 Oryza sativa Japonica Group cDNA clone:J033046N04, full insert sequence.
GenBankAK1016011e-104AK101601.1 Oryza sativa Japonica Group cDNA clone:J033051J21, full insert sequence.
GenBankAK1056441e-104AK105644.1 Oryza sativa Japonica Group cDNA clone:001-200-F05, full insert sequence.
GenBankAY5540321e-104AY554032.1 Oryza sativa (japonica cultivar-group) clone R10191 Hox13 (hox13) mRNA, partial cds.
GenBankCT8310391e-104CT831039.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA023E12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025798128.11e-129homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP31e-107HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A0A9PIJ11e-141A0A0A9PIJ1_ARUDO; Uncharacterized protein
STRINGPavir.Ia04906.1.p1e-129(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.14e-30homeobox protein 6
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]