PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote238047090011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family ARF
Protein Properties Length: 676aa    MW: 75998.9 Da    PI: 6.4239
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote238047090011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.26.5e-23127226197
                                   EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--T CS
                            B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLke 76 
                                   f+k+lt sd++++g +++ +k+a+e+     + +++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +
  Ote238047090011|238047090011 127 FCKILTASDTSTHGGFSVLRKHANEClppldMTQPTPTQDLVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVA 207
                                   99****************************9666677789***************************************** PP

                                   T-EEEEEE-SSSEE..EEEEE CS
                            B3  77 gDfvvFkldgrsefelvvkvf 97 
                                   gD +vF   + +++el+v+v+
  Ote238047090011|238047090011 208 GDCFVFL--RGDNGELRVGVR 226
                                   *******..348899999997 PP

2Auxin_resp103.13.5e-34253332183
                    Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrs 81 
                                   a+ha++t++ F v+Y+Pr+  s+F++ ++k+++++++ +svGmRfkm+fe+eds+err++Gt+vg++d+++ +W++S Wrs
  Ote238047090011|238047090011 253 ASHAITTQTLFVVYYKPRT--SQFIIGLNKYLESMQHGFSVGMRFKMRFEGEDSPERRFTGTIVGIEDFSS-QWTESAWRS 330
                                   789***************6..9**********************************************888.********* PP

                    Auxin_resp  82 Lk 83 
                                   Lk
  Ote238047090011|238047090011 331 LK 332
                                   96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.19E-39121256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.6E-38123242IPR015300DNA-binding pseudobarrel domain
CDDcd100175.07E-20125226No hitNo description
PfamPF023621.2E-20127226IPR003340B3 DNA binding domain
PROSITE profilePS5086311.646127229IPR003340B3 DNA binding domain
SMARTSM010191.0E-19127229IPR003340B3 DNA binding domain
PfamPF065076.9E-32253332IPR010525Auxin response factor
PfamPF023093.8E-6517572IPR033389AUX/IAA domain
SuperFamilySSF542772.8E-15529612No hitNo description
PROSITE profilePS5174529.003536628IPR000270PB1 domain
PfamPF023094.4E-8582626IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MAHADGLVGG GSHERGVGGD DLYTELWKAC AGPLVDVPCM RERVYYFPQG HMEQLEASTN  60
QELDQHIPRF NLPPKILCRV VYMQLLAEPE TDEVYAQITL QPEPDQTEPM SPDPSPPDPP  120
KVAVHSFCKI LTASDTSTHG GFSVLRKHAN ECLPPLDMTQ PTPTQDLVAK DLHGYEWRFK  180
HIFRGQPRRH LLTTGWSTFV TSKRLVAGDC FVFLRGDNGE LRVGVRHLAR HQSSMPPSVI  240
SSQSMHLGVL ATASHAITTQ TLFVVYYKPR TSQFIIGLNK YLESMQHGFS VGMRFKMRFE  300
GEDSPERRFT GTIVGIEDFS SQWTESAWRS LKVQWDEPAT IMRPDRVSPW EIEPFVASTS  360
VDASQPAMKI KRPRPLDLPL NETTTASTAS PIWYPKSTTS VEMSHLTSTN DVQSGETQVF  420
WPPKHPIGVW PSVSNGSLSL FREDDNKNVL LQSVLPNYHS PVSSRASNCL DPIRKSETAS  480
ACRLFGFDLR NSSNKINQAE KESPPKMSET DGKERKDVQM EAPANEGKQS FVPSSRTRIK  540
VQMQGIAVGR GMDLSSFRGY DDLIAELENM FDIKGELRPR NKWEVVYTDN EGDMMLVGDD  600
PWQEFCKMAK KICIYSSDEV KKMSPRCKLP LSSTDGEGTX XXXXXXXXXX XXXXXXILSS  660
AFFLSNNPSD LGYTMW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1731635513355Auxin response factor 1
4ldw_A1e-1731635513355Auxin response factor 1
4ldw_B1e-1731635513355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093958.10.0auxin response factor 18 isoform X2
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A191T8U00.0A0A191T8U0_SALMI; Auxin response factor
STRINGXP_009797447.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]