PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote237891870001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 56aa    MW: 6220.27 Da    PI: 9.4269
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote237891870001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260682.2e-211055146
                        DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46
                                  +CaaCk+lrrkC+++C+++ yfp e+p+kfanvhk+FGasnv kll
  Ote237891870001|237891870001 10 PCAACKFLRRKCVPSCIFSSYFPPEEPHKFANVHKIFGASNVAKLL 55
                                  7*******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089117.427956IPR004883Lateral organ boundaries, LOB
PfamPF031959.7E-211056IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 56 aa     Download sequence    Send to blast
MASTSTYNPP CAACKFLRRK CVPSCIFSSY FPPEEPHKFA NVHKIFGASN VAKLLN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014490594.13e-29PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_014490595.13e-29PREDICTED: protein LATERAL ORGAN BOUNDARIES-like
SwissprotQ9FML42e-29LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A022Q6M16e-29A0A022Q6M1_ERYGU; Uncharacterized protein
STRINGGLYMA05G02530.23e-28(Glycine max)
STRINGGLYMA17G09380.24e-28(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669