PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote237241650001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 104aa    MW: 11831.2 Da    PI: 8.2167
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote237241650001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.23.8e-4511103193
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrrkC ++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+
  Ote237241650001|237241650001  11 PCAACKFLRRKCLPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELQPHQREDAVNSLAYEADMRLRDPVYGCVGVIS 91 
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkae 93 
                                    lq+ql+ql+ +
  Ote237241650001|237241650001  92 LLQHQLRQLQMD 103
                                   *********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.62510104IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4411104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MAXXXXXXTS PCAACKFLRR KCLPECVFAP YFPPDQPQKF ANVHKVFGAS NVTKLLNELQ  60
PHQREDAVNS LAYEADMRLR DPVYGCVGVI SLLQHQLRQL QMDL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012834587.12e-66PREDICTED: LOB domain-containing protein 6
SwissprotQ32SG37e-60LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLS8CFN25e-67S8CFN2_9LAMI; Uncharacterized protein
STRINGSolyc11g008830.1.14e-65(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669