PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote234424100001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 81aa    MW: 8545.81 Da    PI: 9.6651
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote234424100001genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26058.12.5e-189792595
                        DUF260 25 eqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95
                                  +q++++ +v+k+FG++ +++ ++a+pe++r ++++sl++eA  r+  Pv+Gavg++++++++++q+++e++
  Ote234424100001|234424100001  9 AQAHATVFVAKFFGRAGLISSISAVPENQRAALFKSLLFEAAGRTVSPVSGAVGLLSTGNWRVCQAAVETV 79
                                  678999************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.865181IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-15978IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
LQWIDTADAQ AHATVFVAKF FGRAGLISSI SAVPENQRAA LFKSLLFEAA GRTVSPVSGA  60
VGLLSTGNWR VCQAAVETVL R
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010086954.17e-43hypothetical protein L484_005914
RefseqXP_012846657.11e-43PREDICTED: LOB domain-containing protein 38-like
SwissprotQ9FN111e-42LBD37_ARATH; LOB domain-containing protein 37
TrEMBLA0A022QT362e-43A0A022QT36_ERYGU; Uncharacterized protein
TrEMBLA0A068U2155e-43A0A068U215_COFCA; Uncharacterized protein
TrEMBLW9QC497e-43W9QC49_9R
STRINGVIT_07s0129g00330.t011e-41(Vitis vinifera)
STRINGSolyc02g092550.2.16e-42(Solanum lycopersicum)
STRINGPGSC0003DMT4000641857e-42(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9662490