PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100276890051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family TALE
Protein Properties Length: 332aa    MW: 37680.9 Da    PI: 8.163
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100276890051genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.11.5e-082482861854
                                   HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                      Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                   +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  Ote100276890051|100276890051 248 MFQNflHPYPKDSEKHLLALKSGLTRNQVSNWFINARVR 286
                                   6887779******************************88 PP

2BELL71.51.5e-23122190372
                          BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                   + l++kk  Ll lle+Vd++Y+q+ ++++tv s+F+a+++l++ ++++++Al +iS  +++L+++i+ qi
  Ote100276890051|100276890051 122 TSLEAKKKYLLALLEMVDEQYSQCIDEIHTVTSAFHAITELDP-NLHARFALPTISLMYKNLRERISTQI 190
                                   5789***************************************.************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.3E-1854188IPR006563POX domain
PfamPF075262.1E-2160187IPR006563POX domain
PROSITE profilePS5007110.997227290IPR001356Homeobox domain
SMARTSM003892.0E-4230294IPR001356Homeobox domain
CDDcd000862.12E-9230291No hitNo description
SuperFamilySSF466895.13E-15232299IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-25233295IPR009057Homeodomain-like
PfamPF059202.5E-14247286IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MMMDHAGLSS TSRGSSQFSN ELSLSLVVRG NSIPDPCSEL SSSEHASCSS KKPLQLPPLL  60
SGSRYLEAMQ EILAGMACYA LESFEGGSTF PYPSSFVAGR ATVGSSNGLK EINAFGFQKQ  120
ETSLEAKKKY LLALLEMVDE QYSQCIDEIH TVTSAFHAIT ELDPNLHARF ALPTISLMYK  180
NLRERISTQI LASGIHAQER ETKETKSLES CFMQKQWALQ QLSKRDHQLW RPQRGLPETS  240
VSVLRTWMFQ NFLHPYPKDS EKHLLALKSG LTRNQVSNWF INARVRLWKP MIEEMCAEMN  300
RRKARRGDEE VEGNHRNHMH LESRIFTRDS HG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A9e-15236294563Homeobox protein Meis2
3k2a_B9e-15236294563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096864.11e-147PREDICTED: homeobox protein ATH1 isoform X1
SwissprotP487311e-102ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A061GJ281e-120A0A061GJ28_THECC; Homeobox gene 1, putative
STRINGPGSC0003DMT4000769951e-114(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327