PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100270600021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family NAC
Protein Properties Length: 360aa    MW: 40726.8 Da    PI: 4.8333
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100270600021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.54.5e-5261651128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk................................ 49 
                                   lppGfrFhPtdeelv +yL +k++g  +el evi+evd+yk+ePwdLp                                 
  Ote100270600021|100270600021   6 LPPGFRFHPTDEELVAYYLDRKINGGIIEL-EVIPEVDLYKCEPWDLPGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxvd 85 
                                   79***************************9.99***************5589*****************999999988766 PP

                           NAM  50 ..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                      + +++ ewyf+s+rd+ky++g+r+nrat+sgyWkatgkd++v s ++++vg+kktLv+y+grap+g +tdWvmheyrl
  Ote100270600021|100270600021  86 ksFLPSKDMEWYFYSPRDRKYPNGSRTNRATRSGYWKATGKDRAVQS-QKRAVGMKKTLVYYRGRAPHGIRTDWVMHEYRL 165
                                   554444888*************************************9.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.32E-19255IPR003441NAC domain
PROSITE profilePS5100559.5496189IPR003441NAC domain
PfamPF023652.3E-287165IPR003441NAC domain
SuperFamilySSF1019417.32E-3991189IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGAMTLPPGF RFHPTDEELV AYYLDRKING GIIELEVIPE VDLYKCEPWD LPGXXXXXXX  60
XXXXXXXXXX XXXXXXXXXX XXXVDKSFLP SKDMEWYFYS PRDRKYPNGS RTNRATRSGY  120
WKATGKDRAV QSQKRAVGMK KTLVYYRGRA PHGIRTDWVM HEYRLLDSVS ATAPSTLKDS  180
YALCRVFKKN IVIPRSGKQE SAGAAVDQVL WDDDNGATPE TSRDQRETGA DDDHDQNTTK  240
INPSEASSSD VTQTPIAVIS KEHSTAQIPS DEVNSSLDQF YSCHGTENIS NFIQDYTGLF  300
YESWCPPLGM EDFPYMENLG SSGECRLRDY SSGIANLEEI YSLCSTHDTI LNCQNYAGSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-50119012166NO APICAL MERISTEM PROTEIN
1ut4_B2e-50119012166NO APICAL MERISTEM PROTEIN
1ut7_A2e-50119012166NO APICAL MERISTEM PROTEIN
1ut7_B2e-50119012166NO APICAL MERISTEM PROTEIN
3swm_A3e-50119015169NAC domain-containing protein 19
3swm_B3e-50119015169NAC domain-containing protein 19
3swm_C3e-50119015169NAC domain-containing protein 19
3swm_D3e-50119015169NAC domain-containing protein 19
3swp_A3e-50119015169NAC domain-containing protein 19
3swp_B3e-50119015169NAC domain-containing protein 19
3swp_C3e-50119015169NAC domain-containing protein 19
3swp_D3e-50119015169NAC domain-containing protein 19
4dul_A2e-50119012166NAC domain-containing protein 19
4dul_B2e-50119012166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095829.11e-169NAC transcription factor 29
SwissprotQ9FFI52e-79NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A022QM931e-140A0A022QM93_ERYGU; Uncharacterized protein
STRINGMigut.M01499.1.p1e-141(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46212442
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]