PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100260500081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family VOZ
Protein Properties Length: 511aa    MW: 56564.4 Da    PI: 5.5105
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100260500081genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ142.33.6e-44206302194
                           VOZ   1 pppsaflgpkcalwdctrpaqgsewlq...dycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgip 78 
                                   pppsaflg kcalwdc+rpa g  w q   +ycs +ha la  eg pg  pv+rp+gi+lkd+llfaal ak+qgk+vgip
  Ote100260500081|100260500081 206 PPPSAFLGAKCALWDCPRPALGLGWSQepdEYCSVYHAGLAPGEGYPGRPPVVRPGGIGLKDNLLFAALGAKAQGKDVGIP 286
                                   89********************999974446************************************************** PP

                           VOZ  79 ecegaatakspwnaae 94 
                                   ecegaat+kspwna+ 
  Ote100260500081|100260500081 287 ECEGAATTKSPWNAPG 302
                                   **************95 PP

2VOZ215.51.4e-6632545092217
                           VOZ  92 aaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyey 172
                                   ++elfdl++legetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+e+gglkrsyymdpqp++sfewhlyey
  Ote100260500081|100260500081 325 STELFDLTILEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMNEYGGLKRSYYMDPQPMESFEWHLYEY 405
                                   58******************************************************************************* PP

                           VOZ 173 eineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                                   ein++da+alyrle+k vd                 qk+lgrl+a
  Ote100260500081|100260500081 406 EINKYDACALYRLEVKRVDXXXXXXXXXXXXXXXXXQKQLGRLSA 450
                                   ******************************************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MVKGVKSGAC KSASHQLFKD KAKNRVDDLQ GIFSDLQSAR KESRTIDVAV LEEQVHQMLR  60
EWKAELNDPS PASSVQQGGS LGFSSDISRL LQLCEEEDDA SSALAAPKLE PGAPKAADGF  120
TCHQGFNISS NPQEQSFSLA DQCKSTGMGM TNMGMNNMAL ARQLELQSIA LHQELGPQYF  180
VGFDSSSFVG ADGLPQMPGY QHNIYPPPSA FLGAKCALWD CPRPALGLGW SQEPDEYCSV  240
YHAGLAPGEG YPGRPPVVRP GGIGLKDNLL FAALGAKAQG KDVGIPECEG AATTKSPWNA  300
PGKLAHYLSQ LPDFSYVVDV LFLVSTELFD LTILEGETIR EWLFFDKPRR AFESGNRKQR  360
SLPDYNGRGW HESRKQVMNE YGGLKRSYYM DPQPMESFEW HLYEYEINKY DACALYRLEV  420
KRVDXXXXXX XXXXXXXXXX XQKQLGRLSA EFPNEKQHRV VKARGKANAK DGTGSIYPST  480
ATLPSSGEGL EYVRGTPYDY LVDNIDGYYL T
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086027.10.0transcription factor VOZ1-like isoform X1
RefseqXP_011086028.10.0transcription factor VOZ1-like isoform X1
RefseqXP_020551529.10.0transcription factor VOZ1-like isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A4D8ZHY00.0A0A4D8ZHY0_SALSN; Uncharacterized protein
STRINGMigut.M01093.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]