PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100254010181
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HSF
Protein Properties Length: 383aa    MW: 43151.4 Da    PI: 4.6352
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100254010181genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind97.51.3e-30461492102
                                   HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBTTTT...XTTSE CS
                  HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekksks...kekiw 79 
                                   Fl+k++e++ed++++ +isws+ +nsf+v+d+++f++++Lp+yFkhsnf+SF+RQLn+Y                 +++ w
  Ote100254010181|100254010181  46 FLTKTFEMVEDPSTDCVISWSKAKNSFIVWDSHKFSTSLLPRYFKHSNFSSFIRQLNTYVXXXXXXXXLMVGFrkvDPDRW 126
                                   9**********************************************************888777776543324334999* PP

                                   EEEESXXXXXXXXXXXXXXXXXX CS
                  HSF_DNA-bind  80 eFkhksFkkgkkellekikrkks 102
                                   eF+++ F  g+k+ll++i+r+++
  Ote100254010181|100254010181 127 EFANEGFLGGQKHLLKTIRRRRN 149
                                   ********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.107.2E-3539142IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467851.17E-3042147IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004153.7E-5142147IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.6E-144669IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.5E-2846147IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.6E-148496IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.6E-1497109IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MEGVKVKVEE ESTAATGGGG GGPPSAGSSS SPQPMEGLHE VGPPPFLTKT FEMVEDPSTD  60
CVISWSKAKN SFIVWDSHKF STSLLPRYFK HSNFSSFIRQ LNTYVXXXXX XXXLMVGFRK  120
VDPDRWEFAN EGFLGGQKHL LKTIRRRRNV TQGIAHQPGG PFLELEYYGM DEELDKLRRD  180
RNFLMAEIMK LKQQQQISRQ QVLAMEERLR DTETKQQQML VFLAKAFKNP TFVQNYIDKY  240
ARSKKNIEIG QKRRIAMSPS DENLQEVVTI STGSSGFSRD EQEEIADIQL KVESLFSAAM  300
DDESSSELKS LSSGDIWEFL NDEIVVGDEA EDVLAGDHLS DAEVEELVAK TPDWGEDVQD  360
IVHQCDGLSR ASWSNNLPSI TEC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B9e-222214717129Heat shock factor protein 1
5d5v_B9e-222214717129Heat shock factor protein 1
5d5v_D9e-222214717129Heat shock factor protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtDNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020549475.11e-154heat shock factor protein HSF30
SwissprotP411521e-130HSF30_SOLPE; Heat shock factor protein HSF30
TrEMBLA0A4D8Y9011e-166A0A4D8Y901_SALSN; Heat shock transcription factor, other eukaryote
STRINGEOY299281e-138(Theobroma cacao)
STRINGPGSC0003DMT4000212341e-139(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57224113
Publications ? help Back to Top
  1. Scharf KD,Rose S,Thierfelder J,Nover L
    Two cDNAs for tomato heat stress transcription factors.
    Plant Physiol., 1993. 102(4): p. 1355-6
    [PMID:8278556]