PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100249510011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 228aa    MW: 24837.9 Da    PI: 4.7596
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100249510011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26025.53.8e-08239133
                        DUF260  1 aCaaCkvlrrkCakdCvlapyf.....paeqpkkfanv 33
                                  +C++C+vlr++C ++C+l+p++     p++q++++ ++
  Ote100249510011|100249510011  2 SCSGCRVLRKGCIDNCTLRPCLewiesPESQANATLFL 39
                                  6*********************8888877777776665 PP

2DUF26027.31e-0839815799
                        DUF260 57 amsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
                                  +++sl+yeA+ r+  Pv+G+vg++ ++++  +q++++++l+++
  Ote100249510011|100249510011 39 LAKSLLYEACGRIISPVNGSVGLMCSGNWPRCQAAVDAVLRGA 81
                                  789********************************99988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.4E-4238IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-43975IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MSCSGCRVLR KGCIDNCTLR PCLEWIESPE SQANATLFLA KSLLYEACGR IISPVNGSVG  60
LMCSGNWPRC QAAVDAVLRG APLMMQVSDD EDSSAVLPLQ GCDIRHLSKD STAVLSRRRA  120
RNRSKRSSTH AESLVESFAA ELMSESEAKF TITGWYSDED GKNFGEEVKR ARSHDSYSVE  180
TVEPALLSYG VKTEPQLGEI GLDLTLGRDS SLFQGFASTV IEISDSEN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076777.11e-100PREDICTED: LOB domain-containing protein 42-like
TrEMBLA0A022REY63e-82A0A022REY6_ERYGU; Uncharacterized protein
STRINGSolyc05g009320.2.11e-62(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8862494