PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100248430031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 211aa    MW: 23453.1 Da    PI: 6.7834
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100248430031genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26076.93.7e-24966158
                        DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredam 58
                                  +CaaCk++rrkC+++Cv+apyfp ++p+kf  +hk+FGasnv+kll++l+ +ereda 
  Ote100248430031|100248430031  9 PCAACKYQRRKCTPECVFAPYFPPDNPQKFISLHKVFGASNVSKLLNELNVNEREDAY 66
                                  7*****************************************************9874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.8418110IPR004883Lateral organ boundaries, LOB
PfamPF031956.0E-24982IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MRMSSSNAPC AACKYQRRKC TPECVFAPYF PPDNPQKFIS LHKVFGASNV SKLLNELNVN  60
EREDAYLDAQ QIVASAAAAA RQQVIMRNYE QQQNEMMGFN GGFEEAGTAG SVTATGFNQM  120
GGMAMQQLPS LGLGTSYQTI PYQQIQQQGT EQDHANLHPH QLNLHLNQHD ALQHQQHSSS  180
TMQQPEQQQL SHSQRLPLQA PSEDRRIGPA C