PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100247620011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 153aa    MW: 17073.3 Da    PI: 8.3521
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100247620011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.11.3e-42121111100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrrkC ++C++apyfp e+p kf nvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+
  Ote100247620011|100247620011  12 PCAACKFLRRKCLSGCIFAPYFPPEEPTKFFNVHKIFGASNVSKLLNEILPHQREDAVNSLAYEAEARLKDPVYGCVGAIS 92 
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                    lq+q+ ql++el+++k+ 
  Ote100247620011|100247620011  93 VLQRQVLQLQKELDATKAD 111
                                   *************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.90811112IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-4212109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MASSSCSYSN PPCAACKFLR RKCLSGCIFA PYFPPEEPTK FFNVHKIFGA SNVSKLLNEI  60
LPHQREDAVN SLAYEAEARL KDPVYGCVGA ISVLQRQVLQ LQKELDATKA DLMRFTRNET  120
LNITHYSRRI TPYGSGYFYA ENPDAGYSSN SSA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097516.16e-77PREDICTED: LOB domain-containing protein 25-like
SwissprotQ8L8Q31e-66LBD25_ARATH; LOB domain-containing protein 25
TrEMBLM1AY896e-73M1AY89_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000328752e-72(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669