PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100243210021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family LBD
Protein Properties Length: 171aa    MW: 19094 Da    PI: 4.9974
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100243210021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.97e-43161161101
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++kll++lpe++r da++s+vyeA+ar+rdPvyG++g i 
  Ote100243210021|100243210021  16 PCAACKILRRRCVEKCVLAPYFPPTEPLKFTIAHRVFGASNIIKLLQELPEDQRADAVNSMVYEANARLRDPVYGCAGAIC 96 
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkeel 101
                                   +lq+q+ +l+aela++++e+
  Ote100243210021|100243210021  97 HLQKQIGELQAELAKAQAEI 116
                                   ***************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.28515116IPR004883Lateral organ boundaries, LOB
PfamPF031958.9E-4316113IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
FSPPSSPPSP PVILSPCAAC KILRRRCVEK CVLAPYFPPT EPLKFTIAHR VFGASNIIKL  60
LQELPEDQRA DAVNSMVYEA NARLRDPVYG CAGAICHLQK QIGELQAELA KAQAEILNIQ  120
CQNSNLFELI CKQVTEKNDE ENLQQPVSFH ENSSFLLDES VLGMSWEPLW T
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012834486.11e-90PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-75LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A022RH941e-92A0A022RH94_ERYGU; Uncharacterized protein
STRINGSolyc05g048740.2.13e-81(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669